BS22769.complete Sequence
356 bp assembled on 2011-01-25
GenBank Submission: KX803137
> BS22769.complete
GAAGTTATCAGTCGACATGGTTCTCAAAGTGCCGACGTCCAAAGTCCTGC
TAGTCCTGGCCACCTTGTTCGCCGTGGCGGCGATGATCAGCAGCTGGATG
CCCCAGGTGGCGGCCAGTCCGCTCGCACCCACGGAATACGAACAGAGACG
CATGATGTGCTCCACCGGCCTCAGCGATGTGATACAGAAGATATGCGTAA
GCGGAACGGTGGCCCTTGGCGATGTATTTCCCAACAGTTTCGGGAAGCGC
AGGAAGCGCGACTTGCAGAACGTAACCGATTTGTGCTGCAAGTCGGGTGG
CTGCACCTACAGGGAGCTCTTGCAGTACTGCAAAGGATAGAAGCTTTCTA
GACCAT
BS22769.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:28:59
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Ilp6-RD | 324 | CG14049-PD | 1..324 | 17..340 | 1620 | 100 | Plus |
Ilp6-RC | 324 | CG14049-PC | 1..324 | 17..340 | 1620 | 100 | Plus |
Ilp6-RB | 324 | CG14049-PB | 1..324 | 17..340 | 1620 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:29:00
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Ilp6-RA | 1908 | CG14049-RA | 1338..1663 | 15..340 | 1630 | 100 | Plus |
Ilp6-RD | 702 | CG14049-RD | 134..457 | 17..340 | 1620 | 100 | Plus |
Ilp6-RC | 941 | CG14049-RC | 373..696 | 17..340 | 1620 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:28:57
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23542271 | X | 2331926..2332139 | 230..17 | 1070 | 100 | Minus |
X | 23542271 | X | 2331738..2331847 | 340..231 | 550 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-26 15:28:58 has no hits.
BS22769.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-25 17:17:51 Download gff for
BS22769.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Ilp6-RA | 1340..1663 | 17..340 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 00:01:20 Download gff for
BS22769.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Ilp6-RA | 1340..1663 | 17..340 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:42:22 Download gff for
BS22769.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Ilp6-RA | 1340..1663 | 17..340 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:42:22 Download gff for
BS22769.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 2331738..2331847 | 231..340 | 100 | <- | Minus |
X | 2331926..2332139 | 17..230 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 00:01:20 Download gff for
BS22769.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_X | 2225959..2226172 | 17..230 | 100 | | Minus |
arm_X | 2225771..2225880 | 231..340 | 100 | <- | Minus |
BS22769.pep Sequence
Translation from 16 to 339
> BS22769.pep
MVLKVPTSKVLLVLATLFAVAAMISSWMPQVAASPLAPTEYEQRRMMCST
GLSDVIQKICVSGTVALGDVFPNSFGKRRKRDLQNVTDLCCKSGGCTYRE
LLQYCKG*
BS22769.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:06:25
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Ilp6-PD | 107 | CG14049-PD | 1..107 | 1..107 | 554 | 100 | Plus |
Ilp6-PC | 107 | CG14049-PC | 1..107 | 1..107 | 554 | 100 | Plus |
Ilp6-PB | 107 | CG14049-PB | 1..107 | 1..107 | 554 | 100 | Plus |
Ilp6-PA | 107 | CG14049-PA | 1..107 | 1..107 | 554 | 100 | Plus |