BS22774.complete Sequence
248 bp assembled on 2011-01-25
GenBank Submission: KX805997
> BS22774.complete
GAAGTTATCAGTCGACATGGCTCAAATTAAAGGATTGTTTGCTCTCCTCG
CTGTGGTGACCATTGTCCTAATGGTGGCCAACTCGGCTTCGGCCGTGGAT
TGCCCATCTGGAAGATTCAGTGGTCCTTGCTGGGCCTGGGATGGAGAGCA
GTGCCGTCGCCTCTGCAGGGAGGAAGGACGTGTCAGTGGACACTGCAGTG
CCAGTCTGAAGTGCTGGTGCGAACAATGCTGAAAGCTTTCTAGACCAT
BS22774.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:34:49
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Drsl4-RA | 216 | CG32282-PA | 1..216 | 17..232 | 1080 | 100 | Plus |
| Drsl3-RA | 216 | CG32283-PA | 20..214 | 36..230 | 450 | 82.1 | Plus |
| Drsl2-RA | 213 | CG32279-PA | 132..213 | 151..232 | 215 | 84.1 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:34:50
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Drsl4-RA | 323 | CG32282-RA | 18..233 | 17..232 | 1080 | 100 | Plus |
| Drsl3-RA | 360 | CG32283-RA | 58..252 | 36..230 | 450 | 82.1 | Plus |
| Drsl2-RA | 333 | CG32279-RA | 158..240 | 151..233 | 220 | 84.3 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:34:47
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 3L | 28110227 | 3L | 3315637..3315852 | 17..232 | 1080 | 100 | Plus |
| 3L | 28110227 | 3L | 3315053..3315247 | 36..230 | 450 | 82.1 | Plus |
| 3L | 28110227 | 3L | 3314506..3314588 | 151..233 | 220 | 84.3 | Plus |
| 3L | 28110227 | 3L | 3316976..3317034 | 164..222 | 205 | 89.8 | Plus |
| 3L | 28110227 | 3L | 3369763..3369829 | 164..230 | 185 | 85.1 | Plus |
Blast to na_te.dros performed 2014-11-26 15:34:48
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Dvir\Ulysses | 10653 | Dvir\Ulysses DVULYSS 10653bp AKA(S37633) Derived from X56645 (Rel. 38, Last updated, Version 6). | 3408..3472 | 159..224 | 102 | 63.6 | Plus |
BS22774.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-25 17:17:54 Download gff for
BS22774.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| dro4-RA | 1..215 | 17..231 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 00:02:26 Download gff for
BS22774.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| Drsl4-RA | 18..232 | 17..231 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:44:36 Download gff for
BS22774.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| Drsl4-RA | 18..232 | 17..231 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:44:36 Download gff for
BS22774.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 3L | 3315637..3315851 | 17..231 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 00:02:26 Download gff for
BS22774.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_3L | 3315637..3315851 | 17..231 | 100 | | Plus |
BS22774.pep Sequence
Translation from 16 to 231
> BS22774.pep
MAQIKGLFALLAVVTIVLMVANSASAVDCPSGRFSGPCWAWDGEQCRRLC
REEGRVSGHCSASLKCWCEQC*
BS22774.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:13:27
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Drsl4-PA | 71 | CG32282-PA | 1..71 | 1..71 | 394 | 100 | Plus |
| Drsl3-PA | 71 | CG32283-PA | 1..71 | 1..71 | 280 | 69 | Plus |
| Drsl2-PA | 70 | CG32279-PA | 1..70 | 1..71 | 263 | 64.8 | Plus |
| Drs-PA | 70 | CG10810-PA | 1..70 | 1..71 | 257 | 66.2 | Plus |
| Drsl5-PA | 69 | CG10812-PA | 2..69 | 3..71 | 243 | 63.8 | Plus |
