BS22784.complete Sequence
293 bp assembled on 2011-01-25
GenBank Submission: KX803176
> BS22784.complete
GAAGTTATCAGTCGACATGAACTGGGCTACCATAATAATTGCAATTATCC
TCCTGCTGCCAGCCAGCCAGCAAAGCTTTATTAGATCCGAAAGTGTGGAG
GTCAAAGTGCTGTCTTACAATCCCACATACGATTTCTGGTTTTTCATGCC
AACTGGCAGACCCAAGGTGGTTACTCAGAATGTACAGAATGCATATTGGT
CTGCTCGGACAAAAGGAGGTGTTTGCTTCACAGATCTGTGGTTCTACTGC
GCAACTGGCATCGAAATAGAGGAGTAAAAGCTTTCTAGACCAT
BS22784.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:32:13
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG4783-RA | 261 | CG4783-PA | 1..261 | 17..277 | 1305 | 100 | Plus |
| CG4783-RB | 252 | CG4783-PB | 1..252 | 17..277 | 1135 | 96.6 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:32:14
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG4783-RA | 410 | CG4783-RA | 39..304 | 13..278 | 1330 | 100 | Plus |
| CG4783-RB | 401 | CG4783-RB | 39..295 | 13..278 | 1160 | 96.6 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:32:11
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 3R | 32079331 | 3R | 19948596..19948801 | 73..278 | 1030 | 100 | Plus |
| 3R | 32079331 | 3R | 19948481..19948543 | 13..75 | 315 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-26 15:32:12 has no hits.
BS22784.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-25 17:17:53 Download gff for
BS22784.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG4783-RA | 16..274 | 17..275 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 00:01:59 Download gff for
BS22784.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG4783-RA | 16..274 | 17..275 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:43:34 Download gff for
BS22784.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG4783-RA | 43..301 | 17..275 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:43:34 Download gff for
BS22784.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 3R | 19948599..19948798 | 76..275 | 100 | | Plus |
| 3R | 19948485..19948543 | 17..75 | 100 | -> | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 00:01:59 Download gff for
BS22784.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_3R | 15774207..15774265 | 17..75 | 100 | -> | Plus |
| arm_3R | 15774321..15774520 | 76..275 | 100 | | Plus |
BS22784.pep Sequence
Translation from 16 to 276
> BS22784.pep
MNWATIIIAIILLLPASQQSFIRSESVEVKVLSYNPTYDFWFFMPTGRPK
VVTQNVQNAYWSARTKGGVCFTDLWFYCATGIEIEE*
BS22784.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:13:20
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG4783-PA | 86 | CG4783-PA | 1..86 | 1..86 | 462 | 100 | Plus |
| CG4783-PB | 83 | CG4783-PB | 1..83 | 1..86 | 434 | 96.5 | Plus |
