Clone BS22787 Report

Search the DGRC for BS22787

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:227
Well:87
Vector:pDNR-Dual
Associated Gene/TranscriptCG15458-RA
Protein status:BS22787.pep: full length peptide match
Sequenced Size:224

Clone Sequence Records

BS22787.complete Sequence

224 bp assembled on 2011-01-25

GenBank Submission: KX805732

> BS22787.complete
GAAGTTATCAGTCGACATGTCCGATCATTTCAACTTCAACGAAGCCTTCA
ACAGCCAGACCATGCGTGGTCGCGCCAATGTAGCCAAGGCCACCTGGGCC
TCGTTGGGACTCGTCTACGTCCTGGTCAAGATGCACCGCCGCAACACGAA
GCGGCGCGAGACCAAGCTCTACTGCAAGGGCTGCCAGCAGGCCATGCTCC
ATGGCTAGAAGCTTTCTAGACCAT

BS22787.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:51:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG15458-RA 192 CG15458-PA 1..192 17..208 960 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:51:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG15458-RA 486 CG15458-RA 113..304 17..208 960 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:51:39
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 20413834..20413962 208..80 645 100 Minus
X 23542271 X 20414022..20414087 82..17 330 100 Minus
Blast to na_te.dros performed on 2014-11-26 15:51:40 has no hits.

BS22787.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-09 09:37:45 Download gff for BS22787.complete
Subject Subject Range Query Range Percent Splice Strand
CG15458-RA 85..276 17..208 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:58:41 Download gff for BS22787.complete
Subject Subject Range Query Range Percent Splice Strand
CG15458-RA 113..304 17..208 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:21:45 Download gff for BS22787.complete
Subject Subject Range Query Range Percent Splice Strand
CG15458-RA 113..304 17..208 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:21:45 Download gff for BS22787.complete
Subject Subject Range Query Range Percent Splice Strand
X 20413834..20413962 80..208 100 <- Minus
X 20414025..20414087 17..79 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:58:41 Download gff for BS22787.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 20284861..20284989 80..208 100 <- Minus
arm_X 20285052..20285114 17..79 100   Minus

BS22787.pep Sequence

Translation from 16 to 207

> BS22787.pep
MSDHFNFNEAFNSQTMRGRANVAKATWASLGLVYVLVKMHRRNTKRRETK
LYCKGCQQAMLHG*

BS22787.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 19:08:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG15458-PA 63 CG15458-PA 1..63 1..63 337 100 Plus