BS22788.complete Sequence
260 bp assembled on 2011-01-25
GenBank Submission: KX801312
> BS22788.complete
GAAGTTATCAGTCGACATGTCCGACATCAATATCAACCTCAAGTGCGCCG
AGTGCAACCATCCTCGAGGAGTCCTGTACTATGCAAATCCCCTGGCTTGG
GGCCGTCCTTGTCGCCAGTGCCGCAGGATGATGTCCCGAAATGTTGTGGT
TGTTCCCACTCAGGTTGCAGTTCCAGTTGCTACCAACAACAACATCACCA
CCACTACTACATTTGTACCAGTCGCTGCTGTGTCCACCCAATAAAAGCTT
TCTAGACCAT
BS22788.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:51:56
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43773-RA | 228 | CG43773-PA | 1..228 | 17..244 | 1140 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:51:57
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43773-RA | 295 | CG43773-RA | 13..242 | 16..245 | 1150 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:51:54
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 4007702..4007931 | 16..245 | 1150 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-26 15:51:55 has no hits.
BS22788.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-09 09:37:46 Download gff for
BS22788.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG10039-RB | 14..239 | 17..242 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:58:43 Download gff for
BS22788.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43773-RA | 14..239 | 17..242 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:21:49 Download gff for
BS22788.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43773-RA | 14..239 | 17..242 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:21:49 Download gff for
BS22788.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 4007703..4007928 | 17..242 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:58:43 Download gff for
BS22788.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 4007703..4007928 | 17..242 | 100 | | Plus |
BS22788.pep Sequence
Translation from 16 to 243
> BS22788.pep
MSDININLKCAECNHPRGVLYYANPLAWGRPCRQCRRMMSRNVVVVPTQV
AVPVATNNNITTTTTFVPVAAVSTQ*
BS22788.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 19:08:57
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43773-PA | 75 | CG43773-PA | 1..75 | 1..75 | 401 | 100 | Plus |
CG43774-PA | 95 | CG43774-PA | 4..68 | 1..68 | 215 | 62 | Plus |