Clone BS22788 Report

Search the DGRC for BS22788

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:227
Well:88
Vector:pDNR-Dual
Associated Gene/TranscriptCG43773-RA
Protein status:BS22788.pep: gold
Sequenced Size:260

Clone Sequence Records

BS22788.complete Sequence

260 bp assembled on 2011-01-25

GenBank Submission: KX801312

> BS22788.complete
GAAGTTATCAGTCGACATGTCCGACATCAATATCAACCTCAAGTGCGCCG
AGTGCAACCATCCTCGAGGAGTCCTGTACTATGCAAATCCCCTGGCTTGG
GGCCGTCCTTGTCGCCAGTGCCGCAGGATGATGTCCCGAAATGTTGTGGT
TGTTCCCACTCAGGTTGCAGTTCCAGTTGCTACCAACAACAACATCACCA
CCACTACTACATTTGTACCAGTCGCTGCTGTGTCCACCCAATAAAAGCTT
TCTAGACCAT

BS22788.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:51:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG43773-RA 228 CG43773-PA 1..228 17..244 1140 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:51:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG43773-RA 295 CG43773-RA 13..242 16..245 1150 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:51:54
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 4007702..4007931 16..245 1150 100 Plus
Blast to na_te.dros performed on 2014-11-26 15:51:55 has no hits.

BS22788.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-09 09:37:46 Download gff for BS22788.complete
Subject Subject Range Query Range Percent Splice Strand
CG10039-RB 14..239 17..242 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:58:43 Download gff for BS22788.complete
Subject Subject Range Query Range Percent Splice Strand
CG43773-RA 14..239 17..242 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:21:49 Download gff for BS22788.complete
Subject Subject Range Query Range Percent Splice Strand
CG43773-RA 14..239 17..242 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:21:49 Download gff for BS22788.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4007703..4007928 17..242 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:58:43 Download gff for BS22788.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 4007703..4007928 17..242 100   Plus

BS22788.pep Sequence

Translation from 16 to 243

> BS22788.pep
MSDININLKCAECNHPRGVLYYANPLAWGRPCRQCRRMMSRNVVVVPTQV
AVPVATNNNITTTTTFVPVAAVSTQ*

BS22788.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 19:08:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG43773-PA 75 CG43773-PA 1..75 1..75 401 100 Plus
CG43774-PA 95 CG43774-PA 4..68 1..68 215 62 Plus