Clone BS22806 Report

Search the DGRC for BS22806

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:228
Well:6
Vector:pDNR-Dual
Associated Gene/TranscriptCG13427-RA
Protein status:BS22806.pep: full length peptide match
Sequenced Size:350

Clone Sequence Records

BS22806.complete Sequence

350 bp assembled on 2011-01-25

GenBank Submission: KX802476

> BS22806.complete
GAAGTTATCAGTCGACATGAAGTTCGTGGCCATTCTTCTGCTGAGCAGCC
TCACCATTGCGATGGTTTTGGCATTTCCTGATAACGACGATAAAAATGTT
CTTGTGCCAGCTGATATGCAGCATGTTGCTCCACTGGCCGCAGCAGCAGA
TCCCCCGACGTCGGCAGACCAAGTCTCTAACAGCATACGCGGTCCACGCC
ATCTCCTGAGCAAATTGTTCCAGCCCAAGACCGTGGTGGTGCAGCCAGTG
ATTGTGGAGCAGGTGGCTCCAAGACAGTACCCCGGATACGCACAGCCCTA
TCCGTACTACAACCAGGGCCGACGCTACTGGTAGAAGCTTTCTAGACCAT

BS22806.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:24:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG13427-RA 318 CG13427-PA 1..318 17..334 1590 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:24:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG13427-RA 440 CG13427-RA 47..370 12..335 1605 99.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:24:52
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 20538947..20539270 335..12 1605 99.7 Minus
Blast to na_te.dros performed on 2014-11-26 16:24:53 has no hits.

BS22806.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-25 17:14:53 Download gff for BS22806.complete
Subject Subject Range Query Range Percent Splice Strand
CG13427-RA 50..367 17..334 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:56:04 Download gff for BS22806.complete
Subject Subject Range Query Range Percent Splice Strand
CG13427-RA 52..369 17..334 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:03:47 Download gff for BS22806.complete
Subject Subject Range Query Range Percent Splice Strand
CG13427-RA 52..369 17..334 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:03:47 Download gff for BS22806.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20538948..20539265 17..334 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:56:04 Download gff for BS22806.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 16426453..16426770 17..334 100   Minus

BS22806.pep Sequence

Translation from 16 to 333

> BS22806.pep
MKFVAILLLSSLTIAMVLAFPDNDDKNVLVPADMQHVAPLAAAADPPTSA
DQVSNSIRGPRHLLSKLFQPKTVVVQPVIVEQVAPRQYPGYAQPYPYYNQ
GRRYW*

BS22806.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:11:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG13427-PA 105 CG13427-PA 1..105 1..105 545 100 Plus