BS22846.complete Sequence
278 bp assembled on 2011-01-25
GenBank Submission: KX800814
> BS22846.complete
GAAGTTATCAGTCGACATGAAAGCTATCATCGTTTTTATTCTGTTCATTT
CAAGTGTGCATGCTATGAGCAAATGCAACCAAGCAATTTATCTAAATCTT
GATCCTCACTGCGGAATACTTCCCGATTGTAACTTAGATGGTCCAAATCC
AAGTTACCTCAAAAGGGTGTCGTGTGAACGCAAAGAAAACGGAAAACCAG
GATTCATCGAACTAATTCCCGGAAAATGTCTCCATGGTAAACCGCGTTGC
TCGTTAAAATAGAAGCTTTCTAGACCAT
BS22846.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:24:58
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Acp63F-RB | 246 | CG10852-PB | 1..246 | 17..262 | 1230 | 100 | Plus |
| Acp63F-RA | 246 | CG10852-PA | 1..246 | 17..262 | 1230 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:24:59
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Acp63F-RB | 316 | CG10852-RB | 10..255 | 17..262 | 1230 | 100 | Plus |
| Acp63F-RA | 401 | CG10852-RA | 10..255 | 17..262 | 1230 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:24:56
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 3L | 28110227 | 3L | 3816100..3816256 | 201..45 | 785 | 100 | Minus |
| 3L | 28110227 | 3L | 3815985..3816048 | 262..199 | 320 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-26 16:24:57 has no hits.
BS22846.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-25 17:14:54 Download gff for
BS22846.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| Acp63F-RA | 10..248 | 17..255 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:56:06 Download gff for
BS22846.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| Acp63F-RA | 10..248 | 17..255 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:03:48 Download gff for
BS22846.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| Acp63F-RA | 10..248 | 17..255 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:03:48 Download gff for
BS22846.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 3L | 3816101..3816256 | 45..200 | 100 | <- | Minus |
| 3L | 3816318..3816345 | 17..44 | 100 | | Minus |
| 3L | 3815992..3816046 | 201..255 | 100 | <- | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:56:06 Download gff for
BS22846.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_3L | 3816101..3816256 | 45..200 | 100 | <- | Minus |
| arm_3L | 3815992..3816046 | 201..255 | 100 | <- | Minus |
| arm_3L | 3816318..3816345 | 17..44 | 100 | | Minus |
BS22846.pep Sequence
Translation from 16 to 261
> BS22846.pep
MKAIIVFILFISSVHAMSKCNQAIYLNLDPHCGILPDCNLDGPNPSYLKR
VSCERKENGKPGFIELIPGKCLHGKPRCSLK*
BS22846.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:11:30
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Acp63F-PB | 81 | CG10852-PB | 1..81 | 1..81 | 444 | 100 | Plus |
| Acp63F-PA | 81 | CG10852-PA | 1..81 | 1..81 | 444 | 100 | Plus |
