Clone BS22877 Report

Search the DGRC for BS22877

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:228
Well:77
Vector:pDNR-Dual
Associated Gene/TranscriptCG15422-RA
Protein status:BS22877.pep: full length peptide match
Sequenced Size:347

Clone Sequence Records

BS22877.complete Sequence

347 bp assembled on 2011-01-25

GenBank Submission: KX805919

> BS22877.complete
GAAGTTATCAGTCGACATGCGGTACTATGAAGATCCATGTGGCTATCCTC
CTCGCCATCACCATGGTCGTCCAAATATCGAAATTGATGTGGTTCCCGGT
TGGGGTGGCGGCTACTATCCGCCGCCGCCTCCGCCTCGGCCCGCCGAGGT
AGTCTACATGACCCCGGCGGCTACCTATGTGCCCGGCACACAGGTGATAA
TGCCGCAACCCTACGGCGGCGTCACGGTGGCCACCACCAATGGATACTAT
CCGCAGCAGCAGCAGCAGGCGTACGAGTATCAGTACCAGTATCAGCAGCC
CTACAACAATCCACCGTATCCGCAGTGGTGAAAGCTTTCTAGACCAT

BS22877.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:53:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG15422-RA 315 CG15422-PA 1..315 17..331 1575 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:53:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG15422-RA 687 CG15422-RA 73..388 17..332 1580 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:53:28
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 4005056..4005371 17..332 1580 100 Plus
Blast to na_te.dros performed 2014-11-26 15:53:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2344..2419 249..324 145 68.8 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6809..6868 254..312 117 68.3 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6845..6897 254..308 117 73.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6734..6807 254..324 110 64.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6794..6846 254..308 108 69.1 Plus
roo 9092 roo DM_ROO 9092bp 1057..1124 231..299 108 63.8 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6755..6810 254..308 106 67.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6776..6831 254..308 106 67.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6785..6861 232..308 105 62.8 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6773..6829 254..309 102 66.7 Plus

BS22877.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-25 17:18:08 Download gff for BS22877.complete
Subject Subject Range Query Range Percent Splice Strand
CG15422-RA 73..386 17..330 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 00:05:44 Download gff for BS22877.complete
Subject Subject Range Query Range Percent Splice Strand
CG15422-RA 73..386 17..330 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:51:08 Download gff for BS22877.complete
Subject Subject Range Query Range Percent Splice Strand
CG15422-RA 73..386 17..330 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:51:08 Download gff for BS22877.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4005056..4005369 17..330 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 00:05:44 Download gff for BS22877.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 4005056..4005369 17..330 100   Plus

BS22877.pep Sequence

Translation from 16 to 330

> BS22877.pep
MRYYEDPCGYPPRHHHGRPNIEIDVVPGWGGGYYPPPPPPRPAEVVYMTP
AATYVPGTQVIMPQPYGGVTVATTNGYYPQQQQQAYEYQYQYQQPYNNPP
YPQW*

BS22877.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:11:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG15422-PA 104 CG15422-PA 1..104 1..104 619 100 Plus