BS22877.complete Sequence
347 bp assembled on 2011-01-25
GenBank Submission: KX805919
> BS22877.complete
GAAGTTATCAGTCGACATGCGGTACTATGAAGATCCATGTGGCTATCCTC
CTCGCCATCACCATGGTCGTCCAAATATCGAAATTGATGTGGTTCCCGGT
TGGGGTGGCGGCTACTATCCGCCGCCGCCTCCGCCTCGGCCCGCCGAGGT
AGTCTACATGACCCCGGCGGCTACCTATGTGCCCGGCACACAGGTGATAA
TGCCGCAACCCTACGGCGGCGTCACGGTGGCCACCACCAATGGATACTAT
CCGCAGCAGCAGCAGCAGGCGTACGAGTATCAGTACCAGTATCAGCAGCC
CTACAACAATCCACCGTATCCGCAGTGGTGAAAGCTTTCTAGACCAT
BS22877.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:53:30
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG15422-RA | 315 | CG15422-PA | 1..315 | 17..331 | 1575 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:53:32
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG15422-RA | 687 | CG15422-RA | 73..388 | 17..332 | 1580 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:53:28
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 4005056..4005371 | 17..332 | 1580 | 100 | Plus |
Blast to na_te.dros performed 2014-11-26 15:53:29
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 2344..2419 | 249..324 | 145 | 68.8 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 6809..6868 | 254..312 | 117 | 68.3 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 6845..6897 | 254..308 | 117 | 73.2 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 6734..6807 | 254..324 | 110 | 64.9 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 6794..6846 | 254..308 | 108 | 69.1 | Plus |
roo | 9092 | roo DM_ROO 9092bp | 1057..1124 | 231..299 | 108 | 63.8 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 6755..6810 | 254..308 | 106 | 67.9 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 6776..6831 | 254..308 | 106 | 67.9 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 6785..6861 | 232..308 | 105 | 62.8 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 6773..6829 | 254..309 | 102 | 66.7 | Plus |
BS22877.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-25 17:18:08 Download gff for
BS22877.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15422-RA | 73..386 | 17..330 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 00:05:44 Download gff for
BS22877.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15422-RA | 73..386 | 17..330 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:51:08 Download gff for
BS22877.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15422-RA | 73..386 | 17..330 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:51:08 Download gff for
BS22877.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 4005056..4005369 | 17..330 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 00:05:44 Download gff for
BS22877.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 4005056..4005369 | 17..330 | 100 | | Plus |
BS22877.pep Sequence
Translation from 16 to 330
> BS22877.pep
MRYYEDPCGYPPRHHHGRPNIEIDVVPGWGGGYYPPPPPPRPAEVVYMTP
AATYVPGTQVIMPQPYGGVTVATTNGYYPQQQQQAYEYQYQYQQPYNNPP
YPQW*
BS22877.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:11:12
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG15422-PA | 104 | CG15422-PA | 1..104 | 1..104 | 619 | 100 | Plus |