BS22878.complete Sequence
242 bp assembled on 2011-01-25
GenBank Submission: KX802361
> BS22878.complete
GAAGTTATCAGTCGACATGGGAGGCTGTTGCTCAAAGGATTTGGATGACA
AACGCTCGTGGAGTCCCGAGGAGACCAAGAATGGCAGCACCACATCAACA
ATCATTGCCCAGCCGCTGGATGAGGTGGGCACCACCGGTGTCTTCACATT
GACACGCACCACCACTAGCACCACGCGGCAGGAGAAGACGGTGACCACCA
CCAGCGAGGAGCAGGAGCAGGATTAGAAGCTTTCTAGACCAT
BS22878.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:24:40
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG15210-RA | 210 | CG15210-PA | 1..210 | 17..226 | 1050 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:24:41
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG15210-RA | 609 | CG15210-RA | 158..367 | 17..226 | 1050 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:24:38
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23542271 | X | 10839513..10839653 | 86..226 | 705 | 100 | Plus |
X | 23542271 | X | 10839387..10839455 | 17..85 | 345 | 100 | Plus |
Blast to na_te.dros performed 2014-11-26 16:24:39
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dmir\TRIM | 3111 | Dmir\TRIM DMTRIM 3126bp Derived from X59239 (Rel. 35, Last updated, Version 3). | 2784..2838 | 67..120 | 110 | 69.1 | Plus |
BS22878.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-25 17:14:51 Download gff for
BS22878.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15210-RA | 158..367 | 17..226 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:55:59 Download gff for
BS22878.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15210-RA | 158..367 | 17..226 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:03:42 Download gff for
BS22878.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15210-RA | 158..367 | 17..226 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:03:42 Download gff for
BS22878.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 10839513..10839653 | 86..226 | 100 | | Plus |
X | 10839387..10839455 | 17..85 | 100 | -> | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:55:59 Download gff for
BS22878.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_X | 10733546..10733686 | 86..226 | 100 | | Plus |
arm_X | 10733420..10733488 | 17..85 | 100 | -> | Plus |
BS22878.pep Sequence
Translation from 16 to 225
> BS22878.pep
MGGCCSKDLDDKRSWSPEETKNGSTTSTIIAQPLDEVGTTGVFTLTRTTT
STTRQEKTVTTTSEEQEQD*
BS22878.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:11:15
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG15210-PA | 69 | CG15210-PA | 1..69 | 1..69 | 359 | 100 | Plus |