Clone BS22878 Report

Search the DGRC for BS22878

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:228
Well:78
Vector:pDNR-Dual
Associated Gene/TranscriptCG15210-RA
Protein status:BS22878.pep: gold
Sequenced Size:242

Clone Sequence Records

BS22878.complete Sequence

242 bp assembled on 2011-01-25

GenBank Submission: KX802361

> BS22878.complete
GAAGTTATCAGTCGACATGGGAGGCTGTTGCTCAAAGGATTTGGATGACA
AACGCTCGTGGAGTCCCGAGGAGACCAAGAATGGCAGCACCACATCAACA
ATCATTGCCCAGCCGCTGGATGAGGTGGGCACCACCGGTGTCTTCACATT
GACACGCACCACCACTAGCACCACGCGGCAGGAGAAGACGGTGACCACCA
CCAGCGAGGAGCAGGAGCAGGATTAGAAGCTTTCTAGACCAT

BS22878.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:24:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG15210-RA 210 CG15210-PA 1..210 17..226 1050 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:24:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG15210-RA 609 CG15210-RA 158..367 17..226 1050 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:24:38
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 10839513..10839653 86..226 705 100 Plus
X 23542271 X 10839387..10839455 17..85 345 100 Plus
Blast to na_te.dros performed 2014-11-26 16:24:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dmir\TRIM 3111 Dmir\TRIM DMTRIM 3126bp Derived from X59239 (Rel. 35, Last updated, Version 3). 2784..2838 67..120 110 69.1 Plus

BS22878.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-25 17:14:51 Download gff for BS22878.complete
Subject Subject Range Query Range Percent Splice Strand
CG15210-RA 158..367 17..226 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:55:59 Download gff for BS22878.complete
Subject Subject Range Query Range Percent Splice Strand
CG15210-RA 158..367 17..226 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:03:42 Download gff for BS22878.complete
Subject Subject Range Query Range Percent Splice Strand
CG15210-RA 158..367 17..226 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:03:42 Download gff for BS22878.complete
Subject Subject Range Query Range Percent Splice Strand
X 10839513..10839653 86..226 100   Plus
X 10839387..10839455 17..85 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:55:59 Download gff for BS22878.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 10733546..10733686 86..226 100   Plus
arm_X 10733420..10733488 17..85 100 -> Plus

BS22878.pep Sequence

Translation from 16 to 225

> BS22878.pep
MGGCCSKDLDDKRSWSPEETKNGSTTSTIIAQPLDEVGTTGVFTLTRTTT
STTRQEKTVTTTSEEQEQD*

BS22878.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:11:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG15210-PA 69 CG15210-PA 1..69 1..69 359 100 Plus