Clone BS22885 Report

Search the DGRC for BS22885

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:228
Well:85
Vector:pDNR-Dual
Associated Gene/TranscriptAcp54A1-RA
Protein status:BS22885.pep: full length peptide match
Sequenced Size:173

Clone Sequence Records

BS22885.complete Sequence

173 bp assembled on 2011-02-03

GenBank Submission: KX802214

> BS22885.complete
GAAGTTATCAGTCGACATGCTGATCAACCGACATTCCTGTTCGAAACTAC
TTTCTTTGATGGTTTTGCTGTGCTTGGCATTTGACTTAAAACCAGTCTCG
GCGATGAAGTGTCGCCTTGGATTTGTAAAAAGGGGTGGACAATGCACTTG
GCCTTAAAAGCTTTCTAGACCAT

BS22885.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:08:53
Subject Length Description Subject Range Query Range Score Percent Strand
Acp54A1-RA 141 CG34098-PA 1..141 17..157 705 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:08:55
Subject Length Description Subject Range Query Range Score Percent Strand
Acp54A1-RA 306 CG34098-RA 79..221 17..159 715 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 01:08:51
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 17133523..17133665 17..159 715 100 Plus
Blast to na_te.dros performed on 2014-11-27 01:08:52 has no hits.

BS22885.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-02-14 14:32:37 Download gff for BS22885.complete
Subject Subject Range Query Range Percent Splice Strand
Acp54A1-RA 66..204 17..155 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:46:20 Download gff for BS22885.complete
Subject Subject Range Query Range Percent Splice Strand
Acp54A1-RA 66..204 17..155 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:19:29 Download gff for BS22885.complete
Subject Subject Range Query Range Percent Splice Strand
Acp54A1-RA 79..217 17..155 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:19:29 Download gff for BS22885.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17133523..17133661 17..155 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:46:20 Download gff for BS22885.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 13021028..13021166 17..155 100   Plus

BS22885.pep Sequence

Translation from 16 to 156

> BS22885.pep
MLINRHSCSKLLSLMVLLCLAFDLKPVSAMKCRLGFVKRGGQCTWP*

BS22885.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 19:07:18
Subject Length Description Subject Range Query Range Score Percent Strand
Acp54A1-PA 46 CG34098-PA 1..46 1..46 247 100 Plus