BS22885.complete Sequence
173 bp assembled on 2011-02-03
GenBank Submission: KX802214
> BS22885.complete
GAAGTTATCAGTCGACATGCTGATCAACCGACATTCCTGTTCGAAACTAC
TTTCTTTGATGGTTTTGCTGTGCTTGGCATTTGACTTAAAACCAGTCTCG
GCGATGAAGTGTCGCCTTGGATTTGTAAAAAGGGGTGGACAATGCACTTG
GCCTTAAAAGCTTTCTAGACCAT
BS22885.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:08:53
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Acp54A1-RA | 141 | CG34098-PA | 1..141 | 17..157 | 705 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:08:55
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Acp54A1-RA | 306 | CG34098-RA | 79..221 | 17..159 | 715 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 01:08:51
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 17133523..17133665 | 17..159 | 715 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-27 01:08:52 has no hits.
BS22885.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-02-14 14:32:37 Download gff for
BS22885.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Acp54A1-RA | 66..204 | 17..155 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:46:20 Download gff for
BS22885.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Acp54A1-RA | 66..204 | 17..155 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:19:29 Download gff for
BS22885.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Acp54A1-RA | 79..217 | 17..155 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:19:29 Download gff for
BS22885.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 17133523..17133661 | 17..155 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:46:20 Download gff for
BS22885.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 13021028..13021166 | 17..155 | 100 | | Plus |
BS22885.pep Sequence
Translation from 16 to 156
> BS22885.pep
MLINRHSCSKLLSLMVLLCLAFDLKPVSAMKCRLGFVKRGGQCTWP*
BS22885.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 19:07:18
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Acp54A1-PA | 46 | CG34098-PA | 1..46 | 1..46 | 247 | 100 | Plus |