Clone BS22903 Report

Search the DGRC for BS22903

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:229
Well:3
Vector:pDNR-Dual
Associated Gene/TranscriptCG17580-RA
Protein status:BS22903.pep: full length peptide match
Sequenced Size:254

Clone Sequence Records

BS22903.complete Sequence

254 bp assembled on 2011-02-02

GenBank Submission: KX800801

> BS22903.complete
GAAGTTATCAGTCGACATGGGAAACAAGCTGCGCCGCCAACCACAAAGAG
TTGAAGTTGACGAGGAGGAGGTGAGATCCGACCGACCCCAGAAGAAGCCA
CCATCGTCATGGCCCTTCTGGCGCCTGGTCTACTGGCTGGGAGTCCTCAT
CATGGTCATCGGCATCGGTGTGGGCATGTACTTCACCCTCAAGTCGGACT
TCGGTGAGTGCTCCTCCTACGACGTCCGTTGCGATTGAAAGCTTTCTAGA
CCAT

BS22903.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:06:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG17580-RA 222 CG17580-PA 1..222 17..238 1110 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:06:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG17580-RA 1086 CG17580-RA 85..306 17..238 1110 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 22:06:11
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 12806698..12806919 17..238 1110 100 Plus
Blast to na_te.dros performed on 2014-11-26 22:06:11 has no hits.

BS22903.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-02-02 09:57:16 Download gff for BS22903.complete
Subject Subject Range Query Range Percent Splice Strand
CG17580-RA 22..242 17..237 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:46:47 Download gff for BS22903.complete
Subject Subject Range Query Range Percent Splice Strand
CG17580-RA 85..305 17..237 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:51:15 Download gff for BS22903.complete
Subject Subject Range Query Range Percent Splice Strand
CG17580-RA 85..305 17..237 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:51:15 Download gff for BS22903.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12806698..12806918 17..237 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:46:47 Download gff for BS22903.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8694203..8694423 17..237 100   Plus

BS22903.pep Sequence

Translation from 16 to 237

> BS22903.pep
MGNKLRRQPQRVEVDEEEVRSDRPQKKPPSSWPFWRLVYWLGVLIMVIGI
GVGMYFTLKSDFGECSSYDVRCD*

BS22903.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 19:00:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG17580-PA 73 CG17580-PA 1..73 1..73 400 100 Plus