Clone BS23014 Report

Search the DGRC for BS23014

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:230
Well:14
Vector:pDNR-Dual
Associated Gene/TranscriptCG40053-RA
Protein status:BS23014.pep: full length peptide match
Sequenced Size:260

Clone Sequence Records

BS23014.complete Sequence

260 bp assembled on 2011-02-02

GenBank Submission: KX803178

> BS23014.complete
GAAGTTATCAGTCGACATGGCAGGGATCAAAGCAGTGGTCGCCAACATCA
GGAGCAAGGAAGACACCATAAAGCTGTTATTGAGGAAAACGAAACACGAC
AGTCGGCATCAAACCAGTGGCGAAAATTGTGATGAGGGTGTGCGATATCA
GCGGTCGATCGATAGGAAATGGATTTTCAACACGCGGTCACAATGTGGGG
AGCAATCGGCAAAACATGGGAACACCTATATGAACAGGAAGTAGAAGCTT
TCTAGACCAT

BS23014.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed on 2014-11-26 22:02:58 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed on 2014-11-26 22:02:59 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 22:02:56
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 24010382..24010609 244..17 1140 100 Minus
Blast to na_te.dros performed on 2014-11-26 22:02:57 has no hits.

BS23014.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-02-02 09:57:07 Download gff for BS23014.complete
Subject Subject Range Query Range Percent Splice Strand
CG40053-RA 683..910 17..244 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:49:42 Download gff for BS23014.complete
Subject Subject Range Query Range Percent Splice Strand
3L 24010382..24010609 17..244 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:49:42 Download gff for BS23014.complete
Subject Subject Range Query Range Percent Splice Strand
3L 24010382..24010609 17..244 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:44:59 Download gff for BS23014.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 24003482..24003709 17..244 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:44:59 Download gff for BS23014.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 24003482..24003709 17..244 100   Minus

BS23014.pep Sequence

Translation from 16 to 243

> BS23014.pep
MAGIKAVVANIRSKEDTIKLLLRKTKHDSRHQTSGENCDEGVRYQRSIDR
KWIFNTRSQCGEQSAKHGNTYMNRK*
Sequence BS23014.pep has no blast hits.