Clone BS23104 Report

Search the DGRC for BS23104

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:231
Well:4
Vector:pDNR-Dual
Associated Gene/TranscriptCG18107-RA
Protein status:BS23104.pep: full length peptide match
Sequenced Size:206

Clone Sequence Records

BS23104.complete Sequence

206 bp assembled on 2011-01-28

GenBank Submission: KX801177

> BS23104.complete
GAAGTTATCAGTCGACATGCGATTCTTTGCAATCGTCACTGTCTTTGTGC
TTGGTCTTCTGGCTTTGGCCAATGCTATTCCGTTGTCACCCGATCCAGGA
AATGTTATCATCAATGGCGACTGTGTGAATTGCAATGTTCGTGGTGGCAA
ATAGAAATTTTTAATCAAAACTTATATTTAGCATCATAATAAGCTTTCTA
GACCAT

BS23104.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:17:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG18107-RA 138 CG18107-PA 1..138 17..154 690 100 Plus
IM1-RA 138 CG18108-PA 6..138 22..154 305 82 Plus
IM2-RA 138 CG18106-PA 7..107 23..123 235 82.2 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:17:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG18107-RA 281 CG18107-RA 71..246 17..192 880 100 Plus
IM1-RA 361 CG18108-RA 80..219 22..161 310 81.4 Plus
CG15067-RA 711 CG15067-RA 659..711 192..140 265 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:17:17
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 18384758..18384876 74..192 595 100 Plus
2R 25286936 2R 18384637..18384694 17..74 290 100 Plus
Blast to na_te.dros performed 2014-11-26 15:17:19
Subject Length Description Subject Range Query Range Score Percent Strand
gypsy3 6973 gypsy3 GYPSY3 6973bp 6248..6272 91..115 98 88 Plus

BS23104.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-09 09:37:47 Download gff for BS23104.complete
Subject Subject Range Query Range Percent Splice Strand
CG18107-RA 73..246 17..190 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:59:03 Download gff for BS23104.complete
Subject Subject Range Query Range Percent Splice Strand
CG18107-RA 71..244 17..190 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:38:17 Download gff for BS23104.complete
Subject Subject Range Query Range Percent Splice Strand
CG18107-RA 71..244 17..190 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:38:17 Download gff for BS23104.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18384637..18384694 17..74 100 -> Plus
2R 18384759..18384874 75..190 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:59:03 Download gff for BS23104.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 14272142..14272199 17..74 100 -> Plus
arm_2R 14272264..14272379 75..190 100   Plus

BS23104.pep Sequence

Translation from 16 to 153

> BS23104.pep
MRFFAIVTVFVLGLLALANAIPLSPDPGNVIINGDCVNCNVRGGK*

BS23104.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 19:08:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG18107-PA 45 CG18107-PA 1..45 1..45 234 100 Plus
IM2-PA 45 CG18106-PA 1..45 1..45 202 80 Plus
IM1-PA 45 CG18108-PA 1..45 1..45 202 82.2 Plus
IM3-PB 39 CG16844-PB 1..38 1..42 127 69 Plus
IM3-PA 39 CG16844-PA 1..38 1..42 127 69 Plus