Clone BS23116 Report

Search the DGRC for BS23116

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:231
Well:16
Vector:pDNR-Dual
Associated Gene/TranscriptLcp65Ag3-RA
Protein status:BS23116.pep: full length peptide match
Sequenced Size:350

Clone Sequence Records

BS23116.complete Sequence

350 bp assembled on 2011-01-25

GenBank Submission: KX804661

> BS23116.complete
GAAGTTATCAGTCGACATGAAATTCCTGATTGTCTTCGTCGCCCTCTTCG
CCGTGGCTCTGGCTGCTCCTGCCGCTGAGGAACCCACAATCGTGCGCTCT
GAATCCGACGTTGGACCCGAAAGCTTCAAATACGACTGGGAAACCTCCGA
TGGACAGGCTGCTCAAGCTGTAGGTCAGCTGAACGACATTGGAACTGAGA
ACGAGGCTATCTCTGTGAGTGGATCCTACCGCTTCATTGCTGATGATGGC
CAGACCTACCAAGTCAACTACATCGCCGATAAGAACGGATTCCAGCCCGA
GGGTGCTCATCTGCCCGTTGCCCCCGTGGCATAAAAGCTTTCTAGACCAT

BS23116.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:26:21
Subject Length Description Subject Range Query Range Score Percent Strand
Lcp65Ag3-RA 318 CG18779-PA 1..318 17..334 1590 100 Plus
Lcp65Ag1-RA 318 CG10530-PA 1..318 17..334 1575 99.7 Plus
Lcp65Ag2-RA 318 CG10534-PA 1..318 17..334 1560 99.4 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:26:23
Subject Length Description Subject Range Query Range Score Percent Strand
Lcp65Ag3-RA 543 CG18779-RA 60..378 16..334 1595 100 Plus
Lcp65Ag1-RA 517 CG10530-RA 61..379 16..334 1580 99.7 Plus
Lcp65Ag2-RA 543 CG10534-RA 61..379 16..334 1565 99.4 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:26:19
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 6130551..6130749 334..136 995 100 Minus
3L 28110227 3L 6134835..6135033 334..136 980 99.5 Minus
3L 28110227 3L 6133154..6133352 334..136 965 99 Minus
3L 28110227 3L 6130811..6130930 135..16 600 100 Minus
3L 28110227 3L 6133414..6133533 135..16 600 100 Minus
3L 28110227 3L 6135095..6135214 135..16 600 100 Minus
3L 28110227 3L 6137725..6137826 322..221 390 92.2 Minus
3L 28110227 3L 6147563..6147653 334..244 305 89 Minus
3L 28110227 3L 6150434..6150524 334..244 305 89 Minus
3L 28110227 3L 6145194..6145289 221..316 300 87.5 Plus
3L 28110227 3L 6136385..6136555 329..159 255 76.6 Minus
3L 28110227 3L 6136699..6136742 58..15 190 95.5 Minus
Blast to na_te.dros performed on 2014-11-26 16:26:20 has no hits.

BS23116.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-25 17:15:05 Download gff for BS23116.complete
Subject Subject Range Query Range Percent Splice Strand
Lcp65Ag3-RA 58..373 17..332 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:56:42 Download gff for BS23116.complete
Subject Subject Range Query Range Percent Splice Strand
Lcp65Ag3-RA 61..376 17..332 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:04:18 Download gff for BS23116.complete
Subject Subject Range Query Range Percent Splice Strand
Lcp65Ag3-RA 61..376 17..332 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:04:18 Download gff for BS23116.complete
Subject Subject Range Query Range Percent Splice Strand
3L 6130553..6130749 136..332 100 <- Minus
3L 6130811..6130929 17..135 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:56:42 Download gff for BS23116.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 6123653..6123849 136..332 100 <- Minus
arm_3L 6123911..6124029 17..135 100   Minus

BS23116.pep Sequence

Translation from 16 to 333

> BS23116.pep
MKFLIVFVALFAVALAAPAAEEPTIVRSESDVGPESFKYDWETSDGQAAQ
AVGQLNDIGTENEAISVSGSYRFIADDGQTYQVNYIADKNGFQPEGAHLP
VAPVA*

BS23116.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:12:35
Subject Length Description Subject Range Query Range Score Percent Strand
Lcp65Ag3-PA 105 CG18779-PA 1..105 1..105 535 100 Plus
Lcp65Ag1-PA 105 CG10530-PA 1..105 1..105 532 99 Plus
Lcp65Ag2-PA 105 CG10534-PA 1..105 1..105 532 99 Plus
Lcp65Af-PA 100 CG10533-PA 1..99 1..104 348 63.5 Plus
Lcp65Ae-PA 99 CG10529-PA 1..98 1..102 346 66.7 Plus