BS23116.complete Sequence
350 bp assembled on 2011-01-25
GenBank Submission: KX804661
> BS23116.complete
GAAGTTATCAGTCGACATGAAATTCCTGATTGTCTTCGTCGCCCTCTTCG
CCGTGGCTCTGGCTGCTCCTGCCGCTGAGGAACCCACAATCGTGCGCTCT
GAATCCGACGTTGGACCCGAAAGCTTCAAATACGACTGGGAAACCTCCGA
TGGACAGGCTGCTCAAGCTGTAGGTCAGCTGAACGACATTGGAACTGAGA
ACGAGGCTATCTCTGTGAGTGGATCCTACCGCTTCATTGCTGATGATGGC
CAGACCTACCAAGTCAACTACATCGCCGATAAGAACGGATTCCAGCCCGA
GGGTGCTCATCTGCCCGTTGCCCCCGTGGCATAAAAGCTTTCTAGACCAT
BS23116.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:26:21
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Lcp65Ag3-RA | 318 | CG18779-PA | 1..318 | 17..334 | 1590 | 100 | Plus |
Lcp65Ag1-RA | 318 | CG10530-PA | 1..318 | 17..334 | 1575 | 99.7 | Plus |
Lcp65Ag2-RA | 318 | CG10534-PA | 1..318 | 17..334 | 1560 | 99.4 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:26:23
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Lcp65Ag3-RA | 543 | CG18779-RA | 60..378 | 16..334 | 1595 | 100 | Plus |
Lcp65Ag1-RA | 517 | CG10530-RA | 61..379 | 16..334 | 1580 | 99.7 | Plus |
Lcp65Ag2-RA | 543 | CG10534-RA | 61..379 | 16..334 | 1565 | 99.4 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:26:19
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 6130551..6130749 | 334..136 | 995 | 100 | Minus |
3L | 28110227 | 3L | 6134835..6135033 | 334..136 | 980 | 99.5 | Minus |
3L | 28110227 | 3L | 6133154..6133352 | 334..136 | 965 | 99 | Minus |
3L | 28110227 | 3L | 6130811..6130930 | 135..16 | 600 | 100 | Minus |
3L | 28110227 | 3L | 6133414..6133533 | 135..16 | 600 | 100 | Minus |
3L | 28110227 | 3L | 6135095..6135214 | 135..16 | 600 | 100 | Minus |
3L | 28110227 | 3L | 6137725..6137826 | 322..221 | 390 | 92.2 | Minus |
3L | 28110227 | 3L | 6147563..6147653 | 334..244 | 305 | 89 | Minus |
3L | 28110227 | 3L | 6150434..6150524 | 334..244 | 305 | 89 | Minus |
3L | 28110227 | 3L | 6145194..6145289 | 221..316 | 300 | 87.5 | Plus |
3L | 28110227 | 3L | 6136385..6136555 | 329..159 | 255 | 76.6 | Minus |
3L | 28110227 | 3L | 6136699..6136742 | 58..15 | 190 | 95.5 | Minus |
Blast to na_te.dros performed on 2014-11-26 16:26:20 has no hits.
BS23116.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-25 17:15:05 Download gff for
BS23116.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Lcp65Ag3-RA | 58..373 | 17..332 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:56:42 Download gff for
BS23116.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Lcp65Ag3-RA | 61..376 | 17..332 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:04:18 Download gff for
BS23116.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Lcp65Ag3-RA | 61..376 | 17..332 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:04:18 Download gff for
BS23116.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 6130553..6130749 | 136..332 | 100 | <- | Minus |
3L | 6130811..6130929 | 17..135 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:56:42 Download gff for
BS23116.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 6123653..6123849 | 136..332 | 100 | <- | Minus |
arm_3L | 6123911..6124029 | 17..135 | 100 | | Minus |
BS23116.pep Sequence
Translation from 16 to 333
> BS23116.pep
MKFLIVFVALFAVALAAPAAEEPTIVRSESDVGPESFKYDWETSDGQAAQ
AVGQLNDIGTENEAISVSGSYRFIADDGQTYQVNYIADKNGFQPEGAHLP
VAPVA*
BS23116.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:12:35
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Lcp65Ag3-PA | 105 | CG18779-PA | 1..105 | 1..105 | 535 | 100 | Plus |
Lcp65Ag1-PA | 105 | CG10530-PA | 1..105 | 1..105 | 532 | 99 | Plus |
Lcp65Ag2-PA | 105 | CG10534-PA | 1..105 | 1..105 | 532 | 99 | Plus |
Lcp65Af-PA | 100 | CG10533-PA | 1..99 | 1..104 | 348 | 63.5 | Plus |
Lcp65Ae-PA | 99 | CG10529-PA | 1..98 | 1..102 | 346 | 66.7 | Plus |