Clone BS23125 Report

Search the DGRC for BS23125

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:231
Well:25
Vector:pDNR-Dual
Associated Gene/TranscriptCG5189-RA
Protein status:BS23125.pep: full length peptide match
Sequenced Size:410

Clone Sequence Records

BS23125.complete Sequence

410 bp assembled on 2011-01-25

GenBank Submission: KX804075

> BS23125.complete
GAAGTTATCAGTCGACATGTTGAAACCCAAAGCTTTGACGCAGGTTCTCA
GCCAGGCGAACACCGGCGGAGTGGAGAACACCCTCCTGCTCAGCCAGGAG
GGAGCTCTATTGGCCTACTCCGGTTATGGCGATAAGGATGCCAGGATAAC
GGCGGCCATAGCCAGCAACATATGGGCGGCCTACGAGAAGCATGGACGCA
ACGCCTTTCGCGAAGGTCGCCTCACTTTCGTGCTCATCGATTGTGAAAAC
GGTCATGTGGCCATCACACAGGTTGCCAGTGTCCTTTTGTGCCTGTACGC
CAAGCAAACGGTGGGATTGGGTCTTCTGAAGCAAAAGGCCATGTCACTGG
CCTCCTATTTGGAGCGACCGCTTAAGCAGATCTCGGCCTCATAAAAGCTT
TCTAGACCAT

BS23125.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:26:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG5189-RB 378 CG5189-PB 1..378 17..394 1890 100 Plus
CG5189-RA 378 CG5189-PA 1..378 17..394 1890 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:26:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG30120-RB 2533 CG30120-RB 91..468 17..394 1890 100 Plus
CG5189-RB 2533 CG5189-RB 91..468 17..394 1890 100 Plus
CG5189-RA 684 CG5189-RA 91..468 17..394 1890 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:26:44
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 18446764..18446952 85..273 945 100 Plus
2R 25286936 2R 18447014..18447140 268..394 635 100 Plus
2R 25286936 2R 18446638..18446705 17..84 340 100 Plus
Blast to na_te.dros performed on 2014-11-26 16:26:45 has no hits.

BS23125.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-25 17:15:08 Download gff for BS23125.complete
Subject Subject Range Query Range Percent Splice Strand
CG5189-RB 74..444 22..392 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:56:51 Download gff for BS23125.complete
Subject Subject Range Query Range Percent Splice Strand
CG30120-RB 96..466 22..392 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:04:26 Download gff for BS23125.complete
Subject Subject Range Query Range Percent Splice Strand
CG5189-RA 96..466 22..392 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:04:26 Download gff for BS23125.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18446643..18446705 22..84 100 -> Plus
2R 18446764..18446950 85..271 100 -> Plus
2R 18447018..18447138 272..392 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:56:51 Download gff for BS23125.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 14334148..14334210 22..84 100 -> Plus
arm_2R 14334269..14334455 85..271 100 -> Plus
arm_2R 14334523..14334643 272..392 100   Plus

BS23125.pep Sequence

Translation from 16 to 393

> BS23125.pep
MLKPKALTQVLSQANTGGVENTLLLSQEGALLAYSGYGDKDARITAAIAS
NIWAAYEKHGRNAFREGRLTFVLIDCENGHVAITQVASVLLCLYAKQTVG
LGLLKQKAMSLASYLERPLKQISAS*

BS23125.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:12:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG5189-PB 125 CG5189-PB 1..125 1..125 621 100 Plus
CG5189-PA 125 CG5189-PA 1..125 1..125 621 100 Plus