BS23126.complete Sequence
353 bp assembled on 2011-01-25
GenBank Submission: KX804821
> BS23126.complete
GAAGTTATCAGTCGACATGTCACCGAAGACTAAAAAAATGATCGTCAAGA
TTCCGCGCCATCCCTACTTCAATGTGCAGGGCGAACGGAGCGTGGAGCGC
GAGGTGGAGTACCAGGTCCGAAAGTGTCGCGTGAATCTGGAGCGCATCAA
GTCGTCGACTTCTCCGAATTCCCGTCCATTCCCGTTAAAACCGAAGCCCA
AGAGATGCATTGTACGTGTAGCCCGACTGCCGGACGTGGAGCGCAGCGAG
ATTTCCGTGACACCGGCCAGTTCCATCATGAATTCCGACATTGACGAGAA
TAGTGGCAGCGATCAGGAGTCTAATCTGACAATCTAGAAGCTTTCTAGAC
CAT
BS23126.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:26:51
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| HP4-RA | 321 | CG8044-PA | 1..321 | 17..337 | 1605 | 100 | Plus |
| HP4-RB | 303 | CG8044-PB | 1..287 | 17..303 | 1420 | 99.7 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:26:52
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| HP4-RA | 643 | CG8044-RA | 110..431 | 16..337 | 1610 | 100 | Plus |
| HP4-RB | 717 | CG8044-RB | 110..397 | 16..303 | 1425 | 99.7 | Plus |
| HP4-RB | 717 | CG8044-RB | 468..505 | 300..337 | 190 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:26:49
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 3L | 28110227 | 3L | 7975758..7976045 | 303..16 | 1425 | 99.7 | Minus |
| 3L | 28110227 | 3L | 7975650..7975687 | 337..300 | 190 | 100 | Minus |
Blast to na_te.dros performed 2014-11-26 16:26:50
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 2027..2089 | 80..18 | 108 | 63.5 | Minus |
BS23126.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-25 17:15:09 Download gff for
BS23126.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| HP4-RA | 114..434 | 17..337 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:56:53 Download gff for
BS23126.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| HP4-RA | 111..431 | 17..337 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:04:27 Download gff for
BS23126.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| HP4-RA | 111..431 | 17..337 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:04:27 Download gff for
BS23126.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 3L | 7975650..7975687 | 300..337 | 100 | <- | Minus |
| 3L | 7975762..7976044 | 17..299 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:56:53 Download gff for
BS23126.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_3L | 7968862..7969144 | 17..299 | 100 | | Minus |
| arm_3L | 7968750..7968787 | 300..337 | 100 | <- | Minus |
BS23126.pep Sequence
Translation from 16 to 336
> BS23126.pep
MSPKTKKMIVKIPRHPYFNVQGERSVEREVEYQVRKCRVNLERIKSSTSP
NSRPFPLKPKPKRCIVRVARLPDVERSEISVTPASSIMNSDIDENSGSDQ
ESNLTI*
BS23126.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:12:56
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| HP4-PA | 106 | CG8044-PA | 1..106 | 1..106 | 541 | 100 | Plus |
| HP4-PB | 100 | CG8044-PB | 1..95 | 1..95 | 483 | 98.9 | Plus |
