BS23161.complete Sequence
257 bp assembled on 2011-01-25
GenBank Submission: KX800793
> BS23161.complete
GAAGTTATCAGTCGACATGGAGTCAATTAGCAGCATGATTTATTTAGTGG
CCATGATGTCATTGATCATCGGTGGCAGCCAAGCGATTCCTTATCGACCC
TCGGCGTATCTGTACAATCAGCAGTACTGTATGGATACATTGACGGGTCG
GCAGCTTTATATCGGTGAAGTCTTCACGCGAGAGGATCAGTGCGTCCGCA
TCCAATGCCTGGAAACGCTGCAACTCTGGGAGGATAGGTAAAAGCTTTCT
AGACCAT
BS23161.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:28:44
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Vago-RD | 483 | CG2081-PD | 1..221 | 17..237 | 1105 | 100 | Plus |
Vago-RB | 483 | CG2081-PB | 1..221 | 17..237 | 1105 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:28:45
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Vago-RD | 796 | CG2081-RD | 82..302 | 17..237 | 1105 | 100 | Plus |
Vago-RB | 684 | CG2081-RB | 82..302 | 17..237 | 1105 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:28:42
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23542271 | X | 11089521..11089663 | 99..241 | 715 | 100 | Plus |
X | 23542271 | X | 11089371..11089452 | 17..98 | 410 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-26 16:28:43 has no hits.
BS23161.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-25 17:15:24 Download gff for
BS23161.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Vago-RC | 82..304 | 17..239 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:57:47 Download gff for
BS23161.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Vago-RB | 82..304 | 17..239 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:05:14 Download gff for
BS23161.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Vago-RB | 82..304 | 17..239 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:05:14 Download gff for
BS23161.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 11089371..11089452 | 17..98 | 100 | -> | Plus |
X | 11089521..11089661 | 99..239 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:57:47 Download gff for
BS23161.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_X | 10983404..10983485 | 17..98 | 100 | -> | Plus |
arm_X | 10983554..10983694 | 99..239 | 100 | | Plus |
BS23161.pep Sequence
Translation from 16 to 240
> BS23161.pep
MESISSMIYLVAMMSLIIGGSQAIPYRPSAYLYNQQYCMDTLTGRQLYIG
EVFTREDQCVRIQCLETLQLWEDR*
BS23161.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:47:37
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Vago-PD | 160 | CG2081-PD | 1..73 | 1..73 | 381 | 100 | Plus |
Vago-PB | 160 | CG2081-PB | 1..73 | 1..73 | 381 | 100 | Plus |