Clone BS23161 Report

Search the DGRC for BS23161

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:231
Well:61
Vector:pDNR-Dual
Associated Gene/TranscriptVago-RC
Protein status:BS23161.pep: full length peptide match
Sequenced Size:257

Clone Sequence Records

BS23161.complete Sequence

257 bp assembled on 2011-01-25

GenBank Submission: KX800793

> BS23161.complete
GAAGTTATCAGTCGACATGGAGTCAATTAGCAGCATGATTTATTTAGTGG
CCATGATGTCATTGATCATCGGTGGCAGCCAAGCGATTCCTTATCGACCC
TCGGCGTATCTGTACAATCAGCAGTACTGTATGGATACATTGACGGGTCG
GCAGCTTTATATCGGTGAAGTCTTCACGCGAGAGGATCAGTGCGTCCGCA
TCCAATGCCTGGAAACGCTGCAACTCTGGGAGGATAGGTAAAAGCTTTCT
AGACCAT

BS23161.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:28:44
Subject Length Description Subject Range Query Range Score Percent Strand
Vago-RD 483 CG2081-PD 1..221 17..237 1105 100 Plus
Vago-RB 483 CG2081-PB 1..221 17..237 1105 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:28:45
Subject Length Description Subject Range Query Range Score Percent Strand
Vago-RD 796 CG2081-RD 82..302 17..237 1105 100 Plus
Vago-RB 684 CG2081-RB 82..302 17..237 1105 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:28:42
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 11089521..11089663 99..241 715 100 Plus
X 23542271 X 11089371..11089452 17..98 410 100 Plus
Blast to na_te.dros performed on 2014-11-26 16:28:43 has no hits.

BS23161.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-25 17:15:24 Download gff for BS23161.complete
Subject Subject Range Query Range Percent Splice Strand
Vago-RC 82..304 17..239 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:57:47 Download gff for BS23161.complete
Subject Subject Range Query Range Percent Splice Strand
Vago-RB 82..304 17..239 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:05:14 Download gff for BS23161.complete
Subject Subject Range Query Range Percent Splice Strand
Vago-RB 82..304 17..239 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:05:14 Download gff for BS23161.complete
Subject Subject Range Query Range Percent Splice Strand
X 11089371..11089452 17..98 100 -> Plus
X 11089521..11089661 99..239 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:57:47 Download gff for BS23161.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 10983404..10983485 17..98 100 -> Plus
arm_X 10983554..10983694 99..239 100   Plus

BS23161.pep Sequence

Translation from 16 to 240

> BS23161.pep
MESISSMIYLVAMMSLIIGGSQAIPYRPSAYLYNQQYCMDTLTGRQLYIG
EVFTREDQCVRIQCLETLQLWEDR*

BS23161.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:47:37
Subject Length Description Subject Range Query Range Score Percent Strand
Vago-PD 160 CG2081-PD 1..73 1..73 381 100 Plus
Vago-PB 160 CG2081-PB 1..73 1..73 381 100 Plus