Clone BS23240 Report

Search the DGRC for BS23240

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:232
Well:40
Vector:pDNR-Dual
Associated Gene/TranscriptCG6503-RA
Protein status:BS23240.pep: full length peptide match
Sequenced Size:221

Clone Sequence Records

BS23240.complete Sequence

221 bp assembled on 2011-01-25

GenBank Submission: KX800779

> BS23240.complete
GAAGTTATCAGTCGACATGCTTTTGAAATGCACTTGGCTATTGGTTTTGC
TGCTGTCCGTAATGGCAGGTGCCTTTGCCAGCAGCGGATGTCCTGCGGGA
TATAGTGCCGAGAACAATCGGTGCACCATTGAGCGTCCTGTTCACGGCTC
CTGTCCACCCGGATCCTCCTACAGCCTGAACATCAACAAGTGCGTCCACT
CCTAAAAGCTTTCTAGACCAT

BS23240.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:29:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG6503-RB 189 CG6503-PB 1..189 17..205 945 100 Plus
CG6503-RC 189 CG6503-PC 1..189 17..205 945 100 Plus
CG6503-RA 189 CG6503-PA 1..189 17..205 945 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:29:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG6503-RB 348 CG6503-RB 48..238 15..205 955 100 Plus
CG6503-RC 353 CG6503-RC 53..243 15..205 955 100 Plus
CG6503-RA 408 CG6503-RA 108..298 15..205 955 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:29:40
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 26424808..26424998 205..15 955 100 Minus
Blast to na_te.dros performed on 2014-11-26 16:29:41 has no hits.

BS23240.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-25 17:15:32 Download gff for BS23240.complete
Subject Subject Range Query Range Percent Splice Strand
CG6503-RA 110..296 17..203 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:58:14 Download gff for BS23240.complete
Subject Subject Range Query Range Percent Splice Strand
CG6503-RA 110..296 17..203 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:05:39 Download gff for BS23240.complete
Subject Subject Range Query Range Percent Splice Strand
CG6503-RA 110..296 17..203 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:05:39 Download gff for BS23240.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26424810..26424996 17..203 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:58:14 Download gff for BS23240.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 22250532..22250718 17..203 100   Minus

BS23240.pep Sequence

Translation from 16 to 204

> BS23240.pep
MLLKCTWLLVLLLSVMAGAFASSGCPAGYSAENNRCTIERPVHGSCPPGS
SYSLNINKCVHS*

BS23240.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:48:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG6503-PB 62 CG6503-PB 1..62 1..62 336 100 Plus
CG6503-PC 62 CG6503-PC 1..62 1..62 336 100 Plus
CG6503-PA 62 CG6503-PA 1..62 1..62 336 100 Plus
CG34291-PA 61 CG34291-PA 4..59 6..61 135 35.7 Plus