Clone BS23337 Report

Search the DGRC for BS23337

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:233
Well:37
Vector:pDNR-Dual
Associated Gene/TranscriptCG8960-RB
Protein status:BS23337.pep: full length peptide match
Sequenced Size:320

Clone Sequence Records

BS23337.complete Sequence

320 bp assembled on 2011-01-25

GenBank Submission: KX806167

> BS23337.complete
GAAGTTATCAGTCGACATGATCTACTTGATGCGCAAGTGCCTGCAGCTCT
TCTGCATCATCGAGAACCGCGCCGTTCATCCGGCCGAGGAAGAGGAGAAG
GAGGTCAAGTTGCCGGAAAGGGAGATCCTCCAGAAGCGCCGCGGCGGCTT
CACCATCATCCCAGCTGCCATGCACCAGAGCATGCACGGCTTCGGCTACG
GCGAGGGTCACTACCAGATCTTTGTGGAGAAGAAGGAGCGTAACCTCCCA
ACCAAATCGCGCCTTAACGCGGCCACTGCTGAAGTCAAGCTGAATCCCAA
TTAGAAGCTTTCTAGACCAT

BS23337.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:31:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG8960-RB 288 CG8960-PB 1..288 17..304 1440 100 Plus
CG8960-RA 345 CG8960-PA 58..345 17..304 1440 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:31:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG8960-RB 659 CG8960-RB 167..454 17..304 1440 100 Plus
CG8960-RA 1016 CG8960-RA 524..811 17..304 1440 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:31:34
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 2197597..2197884 17..304 1440 100 Plus
Blast to na_te.dros performed on 2014-11-26 16:31:35 has no hits.

BS23337.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-25 17:15:48 Download gff for BS23337.complete
Subject Subject Range Query Range Percent Splice Strand
CG8960-RA 524..811 17..304 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:59:05 Download gff for BS23337.complete
Subject Subject Range Query Range Percent Splice Strand
CG8960-RA 524..811 17..304 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:06:22 Download gff for BS23337.complete
Subject Subject Range Query Range Percent Splice Strand
CG8960-RA 524..811 17..304 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:06:22 Download gff for BS23337.complete
Subject Subject Range Query Range Percent Splice Strand
3L 2197597..2197884 17..304 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:59:05 Download gff for BS23337.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 2197597..2197884 17..304 100   Plus

BS23337.pep Sequence

Translation from 16 to 303

> BS23337.pep
MIYLMRKCLQLFCIIENRAVHPAEEEEKEVKLPEREILQKRRGGFTIIPA
AMHQSMHGFGYGEGHYQIFVEKKERNLPTKSRLNAATAEVKLNPN*

BS23337.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:48:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG8960-PB 95 CG8960-PB 1..95 1..95 498 100 Plus
CG8960-PA 114 CG8960-PA 20..114 1..95 498 100 Plus