BS23377.complete Sequence
464 bp assembled on 2011-01-25
GenBank Submission: KX805365
> BS23377.complete
GAAGTTATCAGTCGACATGGCGGCCTTCATAGCTAAGCAGATGGTTGGAA
ACCAATTAAGTGCCGTTAAAGATGCTGCAGGCGGAGGTGATGGAGGCGAT
GATGGCGACGACAAGGAAAAGGCAGAGGAGGAGGAGAGGGAGCGTCAGGA
GGCCATCAAGGAGGCCGAGGACCGCCGAAAGGAAAAGCACCGGAAAATGG
AGGAGGAGCGCGAGAAGATGAGGCAAGACATTCGCGATAAGTACAACATC
AAGAAGAAGGAGGAGATCGTGGAGGCGGCCCCCCAAGAAGAGCCCAATCC
CCTGATGCGGAAAAAGAAGACGCCCGAGGAACTCGCCGCCGAAGCGGAGC
AGGAAGAGCTCGACGATTTTACAAAACTGAAAAATCAAATAGAAACGCAA
GTAAATGAGCTAAAAACTCAAATAGAGGGAAAATGTGTCATGCAGTGAAA
GCTTTCTAGACCAT
BS23377.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:33:11
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
cpx-RY | 432 | CG32490-PY | 1..432 | 17..448 | 2160 | 100 | Plus |
cpx-RU | 432 | CG32490-PU | 1..432 | 17..448 | 2160 | 100 | Plus |
cpx-RX | 429 | CG32490-PX | 1..429 | 17..448 | 2035 | 98.6 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:33:12
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
cpx-RY | 3544 | CG32490-RY | 337..768 | 17..448 | 2160 | 100 | Plus |
cpx-RU | 5137 | CG32490-RU | 726..1157 | 17..448 | 2160 | 100 | Plus |
cpx-RX | 8078 | CG32490-RX | 607..1035 | 17..448 | 2035 | 98.6 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:33:09
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 4295128..4295286 | 83..241 | 795 | 100 | Plus |
3R | 32079331 | 3R | 4295566..4295700 | 240..374 | 675 | 100 | Plus |
3R | 32079331 | 3R | 4297480..4297561 | 367..448 | 395 | 98.8 | Plus |
3R | 32079331 | 3R | 4284352..4284406 | 17..71 | 275 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-26 16:33:10 has no hits.
BS23377.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-25 17:16:01 Download gff for
BS23377.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
cpx-RU | 560..990 | 17..447 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:59:43 Download gff for
BS23377.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
cpx-RU | 560..990 | 17..447 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:07:01 Download gff for
BS23377.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
cpx-RU | 726..1156 | 17..447 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:07:01 Download gff for
BS23377.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 4297488..4297560 | 375..447 | 100 | | Plus |
3R | 4284352..4284406 | 17..71 | 100 | -> | Plus |
3R | 4295120..4295286 | 72..241 | 96 | -> | Plus |
3R | 4295568..4295700 | 242..374 | 100 | -> | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:59:43 Download gff for
BS23377.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 110074..110128 | 17..71 | 100 | -> | Plus |
arm_3R | 120842..121008 | 72..241 | 96 | -> | Plus |
arm_3R | 121290..121422 | 242..374 | 100 | -> | Plus |
arm_3R | 123210..123282 | 375..447 | 100 | | Plus |
BS23377.pep Sequence
Translation from 16 to 447
> BS23377.pep
MAAFIAKQMVGNQLSAVKDAAGGGDGGDDGDDKEKAEEEERERQEAIKEA
EDRRKEKHRKMEEEREKMRQDIRDKYNIKKKEEIVEAAPQEEPNPLMRKK
KTPEELAAEAEQEELDDFTKLKNQIETQVNELKTQIEGKCVMQ*
BS23377.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:49:19
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
cpx-PY | 143 | CG32490-PY | 1..143 | 1..143 | 725 | 100 | Plus |
cpx-PU | 143 | CG32490-PU | 1..143 | 1..143 | 725 | 100 | Plus |
cpx-PS | 146 | CG32490-PS | 1..146 | 1..143 | 711 | 97.9 | Plus |
cpx-PX | 142 | CG32490-PX | 1..142 | 1..143 | 696 | 97.9 | Plus |
cpx-PV | 142 | CG32490-PV | 1..142 | 1..143 | 696 | 97.9 | Plus |