Clone BS23377 Report

Search the DGRC for BS23377

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:233
Well:77
Vector:pDNR-Dual
Associated Gene/Transcriptcpx-RU
Protein status:BS23377.pep: full length peptide match
Sequenced Size:464

Clone Sequence Records

BS23377.complete Sequence

464 bp assembled on 2011-01-25

GenBank Submission: KX805365

> BS23377.complete
GAAGTTATCAGTCGACATGGCGGCCTTCATAGCTAAGCAGATGGTTGGAA
ACCAATTAAGTGCCGTTAAAGATGCTGCAGGCGGAGGTGATGGAGGCGAT
GATGGCGACGACAAGGAAAAGGCAGAGGAGGAGGAGAGGGAGCGTCAGGA
GGCCATCAAGGAGGCCGAGGACCGCCGAAAGGAAAAGCACCGGAAAATGG
AGGAGGAGCGCGAGAAGATGAGGCAAGACATTCGCGATAAGTACAACATC
AAGAAGAAGGAGGAGATCGTGGAGGCGGCCCCCCAAGAAGAGCCCAATCC
CCTGATGCGGAAAAAGAAGACGCCCGAGGAACTCGCCGCCGAAGCGGAGC
AGGAAGAGCTCGACGATTTTACAAAACTGAAAAATCAAATAGAAACGCAA
GTAAATGAGCTAAAAACTCAAATAGAGGGAAAATGTGTCATGCAGTGAAA
GCTTTCTAGACCAT

BS23377.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:33:11
Subject Length Description Subject Range Query Range Score Percent Strand
cpx-RY 432 CG32490-PY 1..432 17..448 2160 100 Plus
cpx-RU 432 CG32490-PU 1..432 17..448 2160 100 Plus
cpx-RX 429 CG32490-PX 1..429 17..448 2035 98.6 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:33:12
Subject Length Description Subject Range Query Range Score Percent Strand
cpx-RY 3544 CG32490-RY 337..768 17..448 2160 100 Plus
cpx-RU 5137 CG32490-RU 726..1157 17..448 2160 100 Plus
cpx-RX 8078 CG32490-RX 607..1035 17..448 2035 98.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:33:09
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 4295128..4295286 83..241 795 100 Plus
3R 32079331 3R 4295566..4295700 240..374 675 100 Plus
3R 32079331 3R 4297480..4297561 367..448 395 98.8 Plus
3R 32079331 3R 4284352..4284406 17..71 275 100 Plus
Blast to na_te.dros performed on 2014-11-26 16:33:10 has no hits.

BS23377.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-25 17:16:01 Download gff for BS23377.complete
Subject Subject Range Query Range Percent Splice Strand
cpx-RU 560..990 17..447 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:59:43 Download gff for BS23377.complete
Subject Subject Range Query Range Percent Splice Strand
cpx-RU 560..990 17..447 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:07:01 Download gff for BS23377.complete
Subject Subject Range Query Range Percent Splice Strand
cpx-RU 726..1156 17..447 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:07:01 Download gff for BS23377.complete
Subject Subject Range Query Range Percent Splice Strand
3R 4297488..4297560 375..447 100   Plus
3R 4284352..4284406 17..71 100 -> Plus
3R 4295120..4295286 72..241 96 -> Plus
3R 4295568..4295700 242..374 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:59:43 Download gff for BS23377.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 110074..110128 17..71 100 -> Plus
arm_3R 120842..121008 72..241 96 -> Plus
arm_3R 121290..121422 242..374 100 -> Plus
arm_3R 123210..123282 375..447 100   Plus

BS23377.pep Sequence

Translation from 16 to 447

> BS23377.pep
MAAFIAKQMVGNQLSAVKDAAGGGDGGDDGDDKEKAEEEERERQEAIKEA
EDRRKEKHRKMEEEREKMRQDIRDKYNIKKKEEIVEAAPQEEPNPLMRKK
KTPEELAAEAEQEELDDFTKLKNQIETQVNELKTQIEGKCVMQ*

BS23377.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:49:19
Subject Length Description Subject Range Query Range Score Percent Strand
cpx-PY 143 CG32490-PY 1..143 1..143 725 100 Plus
cpx-PU 143 CG32490-PU 1..143 1..143 725 100 Plus
cpx-PS 146 CG32490-PS 1..146 1..143 711 97.9 Plus
cpx-PX 142 CG32490-PX 1..142 1..143 696 97.9 Plus
cpx-PV 142 CG32490-PV 1..142 1..143 696 97.9 Plus