Clone BS23378 Report

Search the DGRC for BS23378

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:233
Well:78
Vector:pDNR-Dual
Associated Gene/Transcriptcpx-RJ
Protein status:BS23378.pep: full length peptide match
Sequenced Size:284

Clone Sequence Records

BS23378.complete Sequence

284 bp assembled on 2011-01-25

GenBank Submission: KX803009

> BS23378.complete
GAAGTTATCAGTCGACATGGAGGAGGAGCGCGAGAAGATGAGGCAAGACA
TTCGCGATAAGTACAACATCAAGAAGAAGGAGGAGATCGTGGAGGCGGCC
CCCCAAGAAGAGCCCAATCCCCTGATGCGGAAAAAGAAGACGCCCGAGGA
ACTCGCCGCCGAAGCGGAGCAGGAAGAGCTCGACGATTTTACAAAACTGA
AAAATCAAATAGAAACGCAAGTAAATGAGCTAAAAACTCAAATAGAGGGA
AAATGTGTCATGCAGTGAAAGCTTTCTAGACCAT

BS23378.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:33:15
Subject Length Description Subject Range Query Range Score Percent Strand
cpx-RAA 378 CG32490-PAA 127..378 17..268 1260 100 Plus
cpx-RY 432 CG32490-PY 181..432 17..268 1260 100 Plus
cpx-RX 429 CG32490-PX 178..429 17..268 1260 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:33:16
Subject Length Description Subject Range Query Range Score Percent Strand
cpx-RAA 3803 CG32490-RA 449..700 17..268 1260 100 Plus
cpx-RY 3544 CG32490-RY 517..768 17..268 1260 100 Plus
cpx-RX 8078 CG32490-RX 784..1035 17..268 1260 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:33:13
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 4295566..4295700 60..194 675 100 Plus
3R 32079331 3R 4297480..4297561 187..268 395 98.8 Plus
3R 32079331 3R 4295242..4295286 17..61 225 100 Plus
Blast to na_te.dros performed on 2014-11-26 16:33:14 has no hits.

BS23378.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-25 17:16:01 Download gff for BS23378.complete
Subject Subject Range Query Range Percent Splice Strand
cpx-RX 498..748 17..267 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:59:45 Download gff for BS23378.complete
Subject Subject Range Query Range Percent Splice Strand
cpx-RX 498..748 17..267 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:07:03 Download gff for BS23378.complete
Subject Subject Range Query Range Percent Splice Strand
cpx-RX 784..1034 17..267 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:07:03 Download gff for BS23378.complete
Subject Subject Range Query Range Percent Splice Strand
3R 4297488..4297560 195..267 100   Plus
3R 4295242..4295286 17..61 100 -> Plus
3R 4295568..4295700 62..194 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:59:45 Download gff for BS23378.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 123210..123282 195..267 100   Plus
arm_3R 120964..121008 17..61 100 -> Plus
arm_3R 121290..121422 62..194 100 -> Plus

BS23378.pep Sequence

Translation from 16 to 267

> BS23378.pep
MEEEREKMRQDIRDKYNIKKKEEIVEAAPQEEPNPLMRKKKTPEELAAEA
EQEELDDFTKLKNQIETQVNELKTQIEGKCVMQ*

BS23378.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:49:21
Subject Length Description Subject Range Query Range Score Percent Strand
cpx-PK 83 CG32490-PK 1..83 1..83 421 100 Plus
cpx-PJ 83 CG32490-PJ 1..83 1..83 421 100 Plus
cpx-PAA 125 CG32490-PAA 43..125 1..83 421 100 Plus
cpx-PL 128 CG32490-PL 46..128 1..83 421 100 Plus
cpx-PW 139 CG32490-PW 57..139 1..83 421 100 Plus