BS23378.complete Sequence
284 bp assembled on 2011-01-25
GenBank Submission: KX803009
> BS23378.complete
GAAGTTATCAGTCGACATGGAGGAGGAGCGCGAGAAGATGAGGCAAGACA
TTCGCGATAAGTACAACATCAAGAAGAAGGAGGAGATCGTGGAGGCGGCC
CCCCAAGAAGAGCCCAATCCCCTGATGCGGAAAAAGAAGACGCCCGAGGA
ACTCGCCGCCGAAGCGGAGCAGGAAGAGCTCGACGATTTTACAAAACTGA
AAAATCAAATAGAAACGCAAGTAAATGAGCTAAAAACTCAAATAGAGGGA
AAATGTGTCATGCAGTGAAAGCTTTCTAGACCAT
BS23378.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:33:15
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
cpx-RAA | 378 | CG32490-PAA | 127..378 | 17..268 | 1260 | 100 | Plus |
cpx-RY | 432 | CG32490-PY | 181..432 | 17..268 | 1260 | 100 | Plus |
cpx-RX | 429 | CG32490-PX | 178..429 | 17..268 | 1260 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:33:16
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
cpx-RAA | 3803 | CG32490-RA | 449..700 | 17..268 | 1260 | 100 | Plus |
cpx-RY | 3544 | CG32490-RY | 517..768 | 17..268 | 1260 | 100 | Plus |
cpx-RX | 8078 | CG32490-RX | 784..1035 | 17..268 | 1260 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:33:13
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 4295566..4295700 | 60..194 | 675 | 100 | Plus |
3R | 32079331 | 3R | 4297480..4297561 | 187..268 | 395 | 98.8 | Plus |
3R | 32079331 | 3R | 4295242..4295286 | 17..61 | 225 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-26 16:33:14 has no hits.
BS23378.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-25 17:16:01 Download gff for
BS23378.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
cpx-RX | 498..748 | 17..267 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:59:45 Download gff for
BS23378.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
cpx-RX | 498..748 | 17..267 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:07:03 Download gff for
BS23378.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
cpx-RX | 784..1034 | 17..267 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:07:03 Download gff for
BS23378.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 4297488..4297560 | 195..267 | 100 | | Plus |
3R | 4295242..4295286 | 17..61 | 100 | -> | Plus |
3R | 4295568..4295700 | 62..194 | 100 | -> | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:59:45 Download gff for
BS23378.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 123210..123282 | 195..267 | 100 | | Plus |
arm_3R | 120964..121008 | 17..61 | 100 | -> | Plus |
arm_3R | 121290..121422 | 62..194 | 100 | -> | Plus |
BS23378.pep Sequence
Translation from 16 to 267
> BS23378.pep
MEEEREKMRQDIRDKYNIKKKEEIVEAAPQEEPNPLMRKKKTPEELAAEA
EQEELDDFTKLKNQIETQVNELKTQIEGKCVMQ*
BS23378.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:49:21
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
cpx-PK | 83 | CG32490-PK | 1..83 | 1..83 | 421 | 100 | Plus |
cpx-PJ | 83 | CG32490-PJ | 1..83 | 1..83 | 421 | 100 | Plus |
cpx-PAA | 125 | CG32490-PAA | 43..125 | 1..83 | 421 | 100 | Plus |
cpx-PL | 128 | CG32490-PL | 46..128 | 1..83 | 421 | 100 | Plus |
cpx-PW | 139 | CG32490-PW | 57..139 | 1..83 | 421 | 100 | Plus |