BS23391.complete Sequence
251 bp assembled on 2011-01-25
GenBank Submission: KX805357
> BS23391.complete
GAAGTTATCAGTCGACATGACTTCTCGCGATAATATTTTCGAGGAAAAAA
TATGCAATAGATTAGATCATTGCGTTTCTGATGTATTAATTAAAGGATGT
GGAGGCGTAATTATTGGATCTGCTGTATCTTTCTTAATTTTAAAGAGACG
AGCATGGCCTGTATGGCTCGGCGCTGGATTTGGAATGGGCATCGCTTATA
GGACGTGTGAAAAGGATTTAAATTCTTTAAAATAAAAGCTTTCTAGACCA
T
BS23391.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:33:38
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG41128-RB | 219 | CG41128-PB | 1..219 | 17..235 | 1095 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:33:40
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG41128-RB | 364 | CG41128-RB | 96..315 | 17..236 | 1100 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:33:36
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 3752167..3752304 | 99..236 | 690 | 100 | Plus |
3R | 32079331 | 3R | 3750458..3750542 | 17..101 | 425 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-26 16:33:37 has no hits.
BS23391.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-25 17:16:04 Download gff for
BS23391.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG41128-RB | 53..269 | 17..233 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:59:57 Download gff for
BS23391.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG41128-RB | 53..269 | 17..233 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:07:13 Download gff for
BS23391.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG41128-RB | 96..312 | 17..233 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:07:13 Download gff for
BS23391.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 3750458..3750539 | 17..98 | 100 | -> | Plus |
3R | 3752167..3752301 | 99..233 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:59:57 Download gff for
BS23391.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3RHet | 1806580..1806714 | 99..233 | 100 | <- | Minus |
3RHet | 1808342..1808423 | 17..98 | 100 | | Minus |
BS23391.pep Sequence
Translation from 16 to 234
> BS23391.pep
MTSRDNIFEEKICNRLDHCVSDVLIKGCGGVIIGSAVSFLILKRRAWPVW
LGAGFGMGIAYRTCEKDLNSLK*
BS23391.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:49:30
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG41128-PB | 72 | CG41128-PB | 1..72 | 1..72 | 385 | 100 | Plus |
CG12479-PA | 74 | CG12479-PA | 6..69 | 9..72 | 218 | 54.7 | Plus |
CG13564-PA | 81 | CG13564-PA | 27..79 | 17..69 | 141 | 45.3 | Plus |