Clone BS23661 Report

Search the DGRC for BS23661

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:236
Well:61
Vector:pDNR-Dual
Associated Gene/TranscriptCG42733-RB
Protein status:BS23661.pep: gold
Sequenced Size:254

Clone Sequence Records

BS23661.complete Sequence

254 bp assembled on 2011-01-25

GenBank Submission: KX800586

> BS23661.complete
GAAGTTATCAGTCGACATGCGGATGCTTTGCGACAGACTCTCCGCCCTGA
CGGCTGGTGCCATGGTCGGCGTTTGGTACGCCCAAAACTTCCCCTGCGAA
AATCCTACGGATGGAGGCGACAAAGATAAGGCCAAGGACAAGGCCAAAAG
CACGGATAAGGGAAAAGAGAAGGAGAAGGATAAGGGGAAGGGGAAGGATG
GTGGCCAGGACAAGGGCAAGGAGAAAGGGAAGGAATAGAAGCTTTCTAGA
CCAT

BS23661.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:51:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG42733-RB 222 CG42733-PB 1..222 17..238 1080 99.1 Plus
CG42733-RC 222 CG42733-PC 1..222 17..238 1080 99.1 Plus
CG42733-RD 294 CG42733-PD 1..211 17..227 1040 99.5 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:51:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG42733-RB 571 CG42733-RB 103..324 17..238 1080 99.1 Plus
CG42733-RC 630 CG42733-RC 103..324 17..238 1080 99.1 Plus
CG42733-RD 519 CG42733-RD 103..313 17..227 1040 99.5 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:51:46
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 10356477..10356698 238..17 1080 99.1 Minus
Blast to na_te.dros performed on 2014-11-26 15:51:47 has no hits.

BS23661.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-25 17:18:06 Download gff for BS23661.complete
Subject Subject Range Query Range Percent Splice Strand
CG42733-RC 103..324 17..238 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 00:05:19 Download gff for BS23661.complete
Subject Subject Range Query Range Percent Splice Strand
CG42733-RC 103..324 17..238 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:50:37 Download gff for BS23661.complete
Subject Subject Range Query Range Percent Splice Strand
CG42733-RC 103..324 17..238 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:50:37 Download gff for BS23661.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10356477..10356698 17..238 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 00:05:19 Download gff for BS23661.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 6243982..6244203 17..238 99   Minus

BS23661.pep Sequence

Translation from 16 to 237

> BS23661.pep
MRMLCDRLSALTAGAMVGVWYAQNFPCENPTDGGDKDKAKDKAKSTDKGK
EKEKDKGKGKDGGQDKGKEKGKE*

BS23661.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:10:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG42733-PB 73 CG12901-PB 1..73 1..73 395 100 Plus
CG42733-PC 73 CG12901-PC 1..73 1..73 395 100 Plus
CG42733-PD 97 CG42733-PD 1..70 1..70 379 100 Plus