Clone BS23706 Report

Search the DGRC for BS23706

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:237
Well:6
Vector:pDNR-Dual
Associated Gene/TranscriptRpLP2-RA
Protein status:BS23706.pep: gold
Sequenced Size:374

Clone Sequence Records

BS23706.complete Sequence

374 bp assembled on 2011-01-27

GenBank Submission: KX800804

> BS23706.complete
GAAGTTATCAGTCGACATGCGTTACGTGGCTGCTTACCTTCTGGCCGTCC
TCGGTGGCAAGGACTCGCCCGCCAACAGCGATCTGGAGAAGATCCTCAGC
TCTGTGGGCGTTGAGGTCGACGCCGAGCGTCTGACCAAGGTCATCAAGGA
GCTGGCTGGCAAGAGCATCGACGACCTGATCAAGGAGGGTCGCGAGAAGC
TCTCCTCGATGCCGGTGGGCGGCGGTGGTGCCGTCGCAGCCGCTGATGCC
GCACCCGCTGCCGCCGCCGGTGGCGACAAGAAGGAGGCCAAGAAGGAGGA
GAAGAAGGAGGAGTCCGAGTCCGAGGATGACGACATGGGCTTCGCTCTCT
TCGAATAAAAGCTTTCTAGACCAT

BS23706.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:34:55
Subject Length Description Subject Range Query Range Score Percent Strand
RpLP2-RA 342 CG4918-PA 1..342 17..358 1710 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:34:56
Subject Length Description Subject Range Query Range Score Percent Strand
RpLP2-RA 604 CG4918-RA 93..436 15..358 1720 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 21:34:54
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 16586221..16586564 15..358 1720 100 Plus
Blast to na_te.dros performed on 2014-11-26 21:34:55 has no hits.

BS23706.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-28 16:06:48 Download gff for BS23706.complete
Subject Subject Range Query Range Percent Splice Strand
RpLP2-RB 130..469 17..356 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:30:49 Download gff for BS23706.complete
Subject Subject Range Query Range Percent Splice Strand
RpLP2-RA 95..434 17..356 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:37:01 Download gff for BS23706.complete
Subject Subject Range Query Range Percent Splice Strand
RpLP2-RA 95..434 17..356 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:37:01 Download gff for BS23706.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16586223..16586562 17..356 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:30:49 Download gff for BS23706.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 12473728..12474067 17..356 100   Plus

BS23706.pep Sequence

Translation from 16 to 357

> BS23706.pep
MRYVAAYLLAVLGGKDSPANSDLEKILSSVGVEVDAERLTKVIKELAGKS
IDDLIKEGREKLSSMPVGGGGAVAAADAAPAAAAGGDKKEAKKEEKKEES
ESEDDDMGFALFE*

BS23706.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:51:29
Subject Length Description Subject Range Query Range Score Percent Strand
RpLP2-PA 113 CG4918-PA 1..113 1..113 551 100 Plus
RpLP1-PB 112 CG4087-PB 28..112 23..113 146 43.6 Plus
RpLP1-PA 112 CG4087-PA 28..112 23..113 146 43.6 Plus