BS23716.complete Sequence
265 bp assembled on 2011-01-27
GenBank Submission: KX806031
> BS23716.complete
GAAGTTATCAGTCGACATGGTGCAGATCAAATTCCTTTTCGTCTTCCTGG
CTGTGATGACAATTGTTGTCCTGGCCGCCAATATGGCTGATGCCGATTGC
CTTTCCGGCAAATACAAGGGTCCCTGCGCCGTCTGGGACAACGAGATGTG
CCGACGTATTTGCAAGGAGGAGGGACATATCAGTGGCCACTGCAGTCCCA
GCCTGAAGTGCTGGTGCGAAGGATGCTGAAAGCTTTCTAGACCATTCGTT
TGGCGCTTAAACGGG
BS23716.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:35:28
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Drsl2-RA | 213 | CG32279-PA | 1..213 | 17..229 | 1065 | 100 | Plus |
| Drs-RA | 213 | CG10810-PA | 1..211 | 17..227 | 470 | 81.5 | Plus |
| Drsl5-RA | 210 | CG10812-PA | 2..208 | 21..227 | 450 | 81.2 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:35:29
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Drsl2-RA | 333 | CG32279-RA | 17..240 | 7..230 | 1075 | 98.7 | Plus |
| Drs-RA | 387 | CG10810-RA | 64..274 | 17..227 | 470 | 81.5 | Plus |
| Drsl5-RA | 364 | CG10812-RA | 56..262 | 21..227 | 450 | 81.2 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 21:35:26
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 3L | 28110227 | 3L | 3314365..3314588 | 7..230 | 1075 | 98.7 | Plus |
| 3L | 28110227 | 3L | 3369619..3369829 | 17..227 | 470 | 81.5 | Plus |
| 3L | 28110227 | 3L | 3316836..3317042 | 21..227 | 450 | 81.2 | Plus |
| 3L | 28110227 | 3L | 3336143..3336362 | 230..17 | 300 | 76.8 | Minus |
| 3L | 28110227 | 3L | 3315771..3315852 | 148..229 | 215 | 84.1 | Plus |
| 3L | 28110227 | 3L | 3335577..3335718 | 231..90 | 215 | 76.8 | Minus |
| 3L | 28110227 | 3L | 3315168..3315247 | 148..227 | 205 | 83.8 | Plus |
Blast to na_te.dros performed 2014-11-26 21:35:27
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Dvir\Ulysses | 10653 | Dvir\Ulysses DVULYSS 10653bp AKA(S37633) Derived from X56645 (Rel. 38, Last updated, Version 6). | 3437..3481 | 186..230 | 99 | 68.9 | Plus |
BS23716.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-28 16:06:49 Download gff for
BS23716.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| dro2-RA | 27..249 | 17..239 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:31:01 Download gff for
BS23716.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| Drsl2-RA | 27..249 | 17..239 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:37:18 Download gff for
BS23716.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| Drsl2-RA | 27..249 | 17..239 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:37:18 Download gff for
BS23716.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 3L | 3314375..3314597 | 17..239 | 98 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:31:01 Download gff for
BS23716.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_3L | 3314375..3314597 | 17..239 | 98 | | Plus |
BS23716.pep Sequence
Translation from 16 to 228
> BS23716.pep
MVQIKFLFVFLAVMTIVVLAANMADADCLSGKYKGPCAVWDNEMCRRICK
EEGHISGHCSPSLKCWCEGC*
BS23716.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:51:32
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Drsl2-PA | 70 | CG32279-PA | 1..70 | 1..70 | 394 | 100 | Plus |
| Drs-PA | 70 | CG10810-PA | 1..70 | 1..70 | 328 | 78.6 | Plus |
| Drsl5-PA | 69 | CG10812-PA | 1..69 | 2..70 | 326 | 79.7 | Plus |
| Drsl6-PA | 72 | CG32268-PA | 1..72 | 1..70 | 299 | 69.4 | Plus |
| Drsl4-PA | 71 | CG32282-PA | 1..71 | 1..70 | 263 | 64.8 | Plus |
