BS23737.complete Sequence
422 bp assembled on 2011-01-27
GenBank Submission: KX806379
> BS23737.complete
GAAGTTATCAGTCGACATGGACAGCAAGCAGCCTCCACCGTACAGTGAAC
AGTCCGGATACACTCCCGCACAAACCTATCAGCCCGGTGGCCCCACCCAG
CCACCACTGTACCCACCGATGCCGCAGCCACCGCAGTCCTCAACGGTGAT
CATCCAGACCACCACAACCTCCAACCTGGTGCCCATCGGCAGTGGACCCA
CCCGCATCCGCTGTCCCTCCTGTCACGCCGAAGTACTGACCACCGTGAAG
TCCACTCCTTCCGGCAGGACGCACTGCTGGGCCCTCATCCTGTGCCTGTT
CATCTGCTGGCCGTGCGTATGCCTACCTTACTGCATGGACTCCTGCCAGA
ATGCCAACCACTACTGCCCCAACTGCAGCGCCTACATCGGCACCTACGAG
AACTAAAAGCTTTCTAGACCAT
BS23737.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:55:49
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13510-RC | 390 | CG13510-PC | 1..390 | 17..406 | 1950 | 100 | Plus |
CG13510-RB | 390 | CG13510-PB | 1..390 | 17..406 | 1950 | 100 | Plus |
CG13510-RA | 390 | CG13510-PA | 1..390 | 17..406 | 1950 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:55:50
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42565-RB | 2577 | CG42565-RB | 89..478 | 17..406 | 1950 | 100 | Plus |
CG13511-RB | 2577 | CG13511-RB | 89..478 | 17..406 | 1950 | 100 | Plus |
CG13510-RC | 2577 | CG13510-RC | 89..478 | 17..406 | 1950 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:55:48
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 22657989..22658275 | 17..303 | 1435 | 100 | Plus |
2R | 25286936 | 2R | 22658923..22659025 | 304..406 | 515 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-26 16:55:48 has no hits.
BS23737.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-28 16:06:36 Download gff for
BS23737.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13510-RA | 85..472 | 17..404 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:13:25 Download gff for
BS23737.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13510-RA | 89..476 | 17..404 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:30:53 Download gff for
BS23737.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13510-RC | 89..476 | 17..404 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:30:53 Download gff for
BS23737.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 22657989..22658275 | 17..303 | 100 | -> | Plus |
2R | 22658923..22659023 | 304..404 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:13:25 Download gff for
BS23737.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 18545494..18545780 | 17..303 | 100 | -> | Plus |
arm_2R | 18546428..18546528 | 304..404 | 100 | | Plus |
BS23737.pep Sequence
Translation from 16 to 405
> BS23737.pep
MDSKQPPPYSEQSGYTPAQTYQPGGPTQPPLYPPMPQPPQSSTVIIQTTT
TSNLVPIGSGPTRIRCPSCHAEVLTTVKSTPSGRTHCWALILCLFICWPC
VCLPYCMDSCQNANHYCPNCSAYIGTYEN*
BS23737.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:57:55
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13510-PC | 129 | CG13510-PC | 1..129 | 1..129 | 745 | 100 | Plus |
CG13510-PB | 129 | CG13510-PB | 1..129 | 1..129 | 745 | 100 | Plus |
CG13510-PA | 129 | CG13510-PA | 1..129 | 1..129 | 745 | 100 | Plus |
CG30273-PB | 128 | CG30273-PB | 16..127 | 4..129 | 263 | 41.3 | Plus |
CG30269-PB | 144 | CG30269-PB | 33..142 | 7..128 | 254 | 41.8 | Plus |