Clone BS23737 Report

Search the DGRC for BS23737

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:237
Well:37
Vector:pDNR-Dual
Associated Gene/TranscriptCG13510-RA
Protein status:BS23737.pep: full length peptide match
Sequenced Size:422

Clone Sequence Records

BS23737.complete Sequence

422 bp assembled on 2011-01-27

GenBank Submission: KX806379

> BS23737.complete
GAAGTTATCAGTCGACATGGACAGCAAGCAGCCTCCACCGTACAGTGAAC
AGTCCGGATACACTCCCGCACAAACCTATCAGCCCGGTGGCCCCACCCAG
CCACCACTGTACCCACCGATGCCGCAGCCACCGCAGTCCTCAACGGTGAT
CATCCAGACCACCACAACCTCCAACCTGGTGCCCATCGGCAGTGGACCCA
CCCGCATCCGCTGTCCCTCCTGTCACGCCGAAGTACTGACCACCGTGAAG
TCCACTCCTTCCGGCAGGACGCACTGCTGGGCCCTCATCCTGTGCCTGTT
CATCTGCTGGCCGTGCGTATGCCTACCTTACTGCATGGACTCCTGCCAGA
ATGCCAACCACTACTGCCCCAACTGCAGCGCCTACATCGGCACCTACGAG
AACTAAAAGCTTTCTAGACCAT

BS23737.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:55:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG13510-RC 390 CG13510-PC 1..390 17..406 1950 100 Plus
CG13510-RB 390 CG13510-PB 1..390 17..406 1950 100 Plus
CG13510-RA 390 CG13510-PA 1..390 17..406 1950 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:55:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG42565-RB 2577 CG42565-RB 89..478 17..406 1950 100 Plus
CG13511-RB 2577 CG13511-RB 89..478 17..406 1950 100 Plus
CG13510-RC 2577 CG13510-RC 89..478 17..406 1950 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:55:48
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 22657989..22658275 17..303 1435 100 Plus
2R 25286936 2R 22658923..22659025 304..406 515 100 Plus
Blast to na_te.dros performed on 2014-11-26 16:55:48 has no hits.

BS23737.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-28 16:06:36 Download gff for BS23737.complete
Subject Subject Range Query Range Percent Splice Strand
CG13510-RA 85..472 17..404 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:13:25 Download gff for BS23737.complete
Subject Subject Range Query Range Percent Splice Strand
CG13510-RA 89..476 17..404 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:30:53 Download gff for BS23737.complete
Subject Subject Range Query Range Percent Splice Strand
CG13510-RC 89..476 17..404 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:30:53 Download gff for BS23737.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22657989..22658275 17..303 100 -> Plus
2R 22658923..22659023 304..404 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:13:25 Download gff for BS23737.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 18545494..18545780 17..303 100 -> Plus
arm_2R 18546428..18546528 304..404 100   Plus

BS23737.pep Sequence

Translation from 16 to 405

> BS23737.pep
MDSKQPPPYSEQSGYTPAQTYQPGGPTQPPLYPPMPQPPQSSTVIIQTTT
TSNLVPIGSGPTRIRCPSCHAEVLTTVKSTPSGRTHCWALILCLFICWPC
VCLPYCMDSCQNANHYCPNCSAYIGTYEN*

BS23737.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:57:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG13510-PC 129 CG13510-PC 1..129 1..129 745 100 Plus
CG13510-PB 129 CG13510-PB 1..129 1..129 745 100 Plus
CG13510-PA 129 CG13510-PA 1..129 1..129 745 100 Plus
CG30273-PB 128 CG30273-PB 16..127 4..129 263 41.3 Plus
CG30269-PB 144 CG30269-PB 33..142 7..128 254 41.8 Plus