Clone BS23742 Report

Search the DGRC for BS23742

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:237
Well:42
Vector:pDNR-Dual
Associated Gene/TranscriptCG13564-RA
Protein status:BS23742.pep: full length peptide match
Sequenced Size:296

Clone Sequence Records

BS23742.complete Sequence

296 bp assembled on 2011-01-27

GenBank Submission: KX800296

> BS23742.complete
GAAGTTATCAGTCGACATGTCCCATGAACCGCAGAAGCCCGCCAAGTCAG
CAGTGAAGGAGCCTCCGGTTGTGAGCGAGGAGACCAGAACCACGGACAAG
TGCCTGGCGGACTTTTGCTTGAAGGGTGGAAGTGGCCTGATCATCGGCAG
CGCGGTCACCTTGTTCTTCACGCGCCCACAAACCTATCCCATTTGGCTGG
GACTGGGCGTCGGTATGGGCGTGGCCTACGACTGCTGCCAGGCCCGCTGG
AATCAACAGTAGAAGCTTTCTAGACCATTCGTTTGGCGCTCTAAGG

BS23742.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:56:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG13564-RA 246 CG13564-PA 1..246 17..262 1230 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:56:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG13564-RA 500 CG13564-RA 99..344 17..262 1230 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:56:06
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 24081023..24081268 17..262 1230 100 Plus
Blast to na_te.dros performed on 2014-11-26 16:56:07 has no hits.

BS23742.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-28 16:06:36 Download gff for BS23742.complete
Subject Subject Range Query Range Percent Splice Strand
CG13564-RA 99..348 17..268 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:13:32 Download gff for BS23742.complete
Subject Subject Range Query Range Percent Splice Strand
CG13564-RA 99..348 17..268 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:31:01 Download gff for BS23742.complete
Subject Subject Range Query Range Percent Splice Strand
CG13564-RA 99..348 17..268 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:31:01 Download gff for BS23742.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24081023..24081272 17..268 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:13:32 Download gff for BS23742.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 19968546..19968795 17..268 98   Plus

BS23742.pep Sequence

Translation from 16 to 261

> BS23742.pep
MSHEPQKPAKSAVKEPPVVSEETRTTDKCLADFCLKGGSGLIIGSAVTLF
FTRPQTYPIWLGLGVGMGVAYDCCQARWNQQ*

BS23742.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:57:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG13564-PA 81 CG13564-PA 1..81 1..81 441 100 Plus
CG12479-PA 74 CG12479-PA 14..66 27..79 150 50.9 Plus
CG41128-PB 72 CG41128-PB 17..69 27..79 141 45.3 Plus