Clone BS23746 Report

Search the DGRC for BS23746

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:237
Well:46
Vector:pDNR-Dual
Associated Gene/TranscriptCG13227-RA
Protein status:BS23746.pep: gold
Sequenced Size:395

Clone Sequence Records

BS23746.complete Sequence

395 bp assembled on 2011-01-27

GenBank Submission: KX804311

> BS23746.complete
GAAGTTATCAGTCGACATGGATCACAAGTGGATAATATTTTTCTTCAGCA
TTGCTGCTCTGCTCTTATGCAATTTTGTTAGAGCCGATGAAACGGAAACG
GAAGTGGTGCAGGAGAAACCAAGCTCTATTCAGCTGCTGGACGCCGGAGA
AACGGCCCAGTCTGATTCCACAGACGAGAACGTTAGGAAAGTGCGCCAGT
ACTTTGGACCACCACCGTTTGGACCACCGCCACCACCCTTCTTTGGACCA
CCTCCACCACCGTACTACGGCGGCGGCTTTGGTGGCGGATTCGGCGGTGG
TTTCCAGAGAACTCGAGTGGTCACCCGCACCCGTTACCGCGGACGCGGTG
GTTACTATGGCGGTGGATTCTACGGCTAAAAGCTTTCTAGACCAT

BS23746.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:55:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG13227-RA 363 CG13227-PA 1..363 17..379 1815 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:55:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG13227-RA 504 CG13227-RA 34..401 12..379 1825 99.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:55:31
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 11235285..11235652 12..379 1825 99.7 Plus
Blast to na_te.dros performed on 2014-11-26 16:55:31 has no hits.

BS23746.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-28 16:06:35 Download gff for BS23746.complete
Subject Subject Range Query Range Percent Splice Strand
CG13227-RA 37..397 17..377 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:13:17 Download gff for BS23746.complete
Subject Subject Range Query Range Percent Splice Strand
CG13227-RA 39..399 17..377 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:30:44 Download gff for BS23746.complete
Subject Subject Range Query Range Percent Splice Strand
CG13227-RA 39..399 17..377 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:30:44 Download gff for BS23746.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11235290..11235650 17..377 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:13:17 Download gff for BS23746.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 7122795..7123155 17..377 100   Plus

BS23746.pep Sequence

Translation from 16 to 378

> BS23746.pep
MDHKWIIFFFSIAALLLCNFVRADETETEVVQEKPSSIQLLDAGETAQSD
STDENVRKVRQYFGPPPFGPPPPPFFGPPPPPYYGGGFGGGFGGGFQRTR
VVTRTRYRGRGGYYGGGFYG*

BS23746.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:57:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG13227-PA 120 CG13227-PA 1..120 1..120 668 100 Plus