BS23749.complete Sequence
371 bp assembled on 2011-01-27
GenBank Submission: KX801961
> BS23749.complete
GAAGTTATCAGTCGACATGCGTCTTCTGCTCATCCTCTCAGTTGTCCTGG
CCGTGATCCTCGGCTGCCACGCCTACAGCGCCACCTGGGGGCGCAGGGTC
AACAACGATTTCCTCCTCTCACGCACCAGGGAAGTTCGCAATCCGATCAA
GAACAACTACTGGAACGTGAACGTGAACTACCCCAATGGATTCTACAACA
TCTCCGCCGTGATCGTGTACGACAACTTCAAGAACAACTCTGGAGCATCT
CCTAGCCTCTATTCCGGCGGTCCGGGCTACCGCTTTGCCACCGTGAATCT
TCGTGGTCAGGTGAACCGCGGAATCGACTCCACCGTCGAGATCTGGGGTC
GTTAAAAGCTTTCTAGACCAT
BS23749.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:56:12
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13324-RA | 339 | CG13324-PA | 1..339 | 17..355 | 1695 | 100 | Plus |
CG13323-RB | 339 | CG13323-PB | 1..339 | 17..355 | 1305 | 92.3 | Plus |
CG13323-RA | 339 | CG13323-PA | 1..339 | 17..355 | 1305 | 92.3 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:56:13
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13324-RA | 511 | CG13324-RA | 37..377 | 15..355 | 1705 | 100 | Plus |
CG13323-RB | 2562 | CG13323-RB | 39..379 | 15..355 | 1315 | 92.4 | Plus |
CG13323-RA | 521 | CG13323-RA | 39..379 | 15..355 | 1315 | 92.4 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:56:10
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 13049280..13049620 | 355..15 | 1705 | 100 | Minus |
2R | 25286936 | 2R | 13046878..13047218 | 355..15 | 1315 | 92.4 | Minus |
Blast to na_te.dros performed on 2014-11-26 16:56:11 has no hits.
BS23749.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-28 16:06:37 Download gff for
BS23749.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13324-RA | 1..337 | 17..353 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:13:34 Download gff for
BS23749.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13324-RA | 20..356 | 17..353 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:31:02 Download gff for
BS23749.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13324-RA | 39..375 | 17..353 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:31:02 Download gff for
BS23749.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 13049282..13049618 | 17..353 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:13:34 Download gff for
BS23749.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 8936787..8937123 | 17..353 | 100 | | Minus |
BS23749.pep Sequence
Translation from 16 to 354
> BS23749.pep
MRLLLILSVVLAVILGCHAYSATWGRRVNNDFLLSRTREVRNPIKNNYWN
VNVNYPNGFYNISAVIVYDNFKNNSGASPSLYSGGPGYRFATVNLRGQVN
RGIDSTVEIWGR*
BS23749.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:57:58
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13324-PA | 112 | CG13324-PA | 1..112 | 1..112 | 595 | 100 | Plus |
CG13323-PB | 112 | CG13323-PB | 1..112 | 1..112 | 562 | 94.6 | Plus |
CG13323-PA | 112 | CG13323-PA | 1..112 | 1..112 | 562 | 94.6 | Plus |
CG31789-PC | 117 | CG31789-PC | 4..114 | 1..110 | 141 | 28.9 | Plus |
CG31789-PB | 117 | CG31789-PB | 4..114 | 1..110 | 141 | 28.9 | Plus |