Clone BS23749 Report

Search the DGRC for BS23749

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:237
Well:49
Vector:pDNR-Dual
Associated Gene/TranscriptCG13324-RA
Protein status:BS23749.pep: gold
Sequenced Size:371

Clone Sequence Records

BS23749.complete Sequence

371 bp assembled on 2011-01-27

GenBank Submission: KX801961

> BS23749.complete
GAAGTTATCAGTCGACATGCGTCTTCTGCTCATCCTCTCAGTTGTCCTGG
CCGTGATCCTCGGCTGCCACGCCTACAGCGCCACCTGGGGGCGCAGGGTC
AACAACGATTTCCTCCTCTCACGCACCAGGGAAGTTCGCAATCCGATCAA
GAACAACTACTGGAACGTGAACGTGAACTACCCCAATGGATTCTACAACA
TCTCCGCCGTGATCGTGTACGACAACTTCAAGAACAACTCTGGAGCATCT
CCTAGCCTCTATTCCGGCGGTCCGGGCTACCGCTTTGCCACCGTGAATCT
TCGTGGTCAGGTGAACCGCGGAATCGACTCCACCGTCGAGATCTGGGGTC
GTTAAAAGCTTTCTAGACCAT

BS23749.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:56:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG13324-RA 339 CG13324-PA 1..339 17..355 1695 100 Plus
CG13323-RB 339 CG13323-PB 1..339 17..355 1305 92.3 Plus
CG13323-RA 339 CG13323-PA 1..339 17..355 1305 92.3 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:56:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG13324-RA 511 CG13324-RA 37..377 15..355 1705 100 Plus
CG13323-RB 2562 CG13323-RB 39..379 15..355 1315 92.4 Plus
CG13323-RA 521 CG13323-RA 39..379 15..355 1315 92.4 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:56:10
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 13049280..13049620 355..15 1705 100 Minus
2R 25286936 2R 13046878..13047218 355..15 1315 92.4 Minus
Blast to na_te.dros performed on 2014-11-26 16:56:11 has no hits.

BS23749.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-28 16:06:37 Download gff for BS23749.complete
Subject Subject Range Query Range Percent Splice Strand
CG13324-RA 1..337 17..353 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:13:34 Download gff for BS23749.complete
Subject Subject Range Query Range Percent Splice Strand
CG13324-RA 20..356 17..353 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:31:02 Download gff for BS23749.complete
Subject Subject Range Query Range Percent Splice Strand
CG13324-RA 39..375 17..353 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:31:02 Download gff for BS23749.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13049282..13049618 17..353 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:13:34 Download gff for BS23749.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8936787..8937123 17..353 100   Minus

BS23749.pep Sequence

Translation from 16 to 354

> BS23749.pep
MRLLLILSVVLAVILGCHAYSATWGRRVNNDFLLSRTREVRNPIKNNYWN
VNVNYPNGFYNISAVIVYDNFKNNSGASPSLYSGGPGYRFATVNLRGQVN
RGIDSTVEIWGR*

BS23749.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:57:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG13324-PA 112 CG13324-PA 1..112 1..112 595 100 Plus
CG13323-PB 112 CG13323-PB 1..112 1..112 562 94.6 Plus
CG13323-PA 112 CG13323-PA 1..112 1..112 562 94.6 Plus
CG31789-PC 117 CG31789-PC 4..114 1..110 141 28.9 Plus
CG31789-PB 117 CG31789-PB 4..114 1..110 141 28.9 Plus