Clone BS23754 Report

Search the DGRC for BS23754

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:237
Well:54
Vector:pDNR-Dual
Associated Gene/TranscriptCG16824-RA
Protein status:BS23754.pep: full length peptide match
Sequenced Size:227

Clone Sequence Records

BS23754.complete Sequence

227 bp assembled on 2011-01-27

GenBank Submission: KX804087

> BS23754.complete
GAAGTTATCAGTCGACATGGCTGGACGCGAGGGCGGTAAGAAGAAGCCTC
TAAAGGCGCCCAAGAAGGACTCGAAGAATCTAGACGAGGAGGACATGGCC
TTCAAACAGAAGCAGAAGGAGCAGCAGAAGGCTATGGAGGCGGCCAAGGC
AGGTGCCTCCAAGAAGGGACCTCTTCTTGGCGGCGGTATCAAAAAGTCAG
GCAAAAAGTGAAAGCTTTCTAGACCAT

BS23754.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:56:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG16824-RA 195 CG16824-PA 1..195 17..211 960 99.5 Plus
CG13364-RA 195 CG13364-PA 1..195 17..211 570 86.2 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:56:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG16824-RA 407 CG16824-RA 71..265 17..211 960 99.5 Plus
CG13364-RA 387 CG13364-RA 54..249 17..212 575 86.2 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:56:43
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 13293079..13293273 17..211 960 99.5 Plus
X 23542271 X 624895..625090 212..17 575 86.2 Minus
Blast to na_te.dros performed on 2014-11-26 16:56:43 has no hits.

BS23754.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-28 16:06:38 Download gff for BS23754.complete
Subject Subject Range Query Range Percent Splice Strand
CG16824-RA 71..264 17..210 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:13:45 Download gff for BS23754.complete
Subject Subject Range Query Range Percent Splice Strand
CG16824-RA 71..264 17..210 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:31:16 Download gff for BS23754.complete
Subject Subject Range Query Range Percent Splice Strand
CG16824-RA 71..264 17..210 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:31:16 Download gff for BS23754.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13293079..13293272 17..210 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:13:45 Download gff for BS23754.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 13293079..13293272 17..210 99   Plus

BS23754.pep Sequence

Translation from 16 to 210

> BS23754.pep
MAGREGGKKKPLKAPKKDSKNLDEEDMAFKQKQKEQQKAMEAAKAGASKK
GPLLGGGIKKSGKK*

BS23754.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:58:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG16824-PA 64 CG16824-PA 1..64 1..64 324 100 Plus
CG13364-PA 64 CG13364-PA 1..64 1..64 301 90.6 Plus