Clone BS23759 Report

Search the DGRC for BS23759

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:237
Well:59
Vector:pDNR-Dual
Associated Gene/TranscriptCG14377-RA
Protein status:BS23759.pep: gold
Sequenced Size:350

Clone Sequence Records

BS23759.complete Sequence

350 bp assembled on 2011-01-27

GenBank Submission: KX800718

> BS23759.complete
GAAGTTATCAGTCGACATGAAGTTCCTCATCTGTTTGACCCTGTGCATTG
CCGCCGCCCAGGCAGGATTCATCGCATCTCCAGTGGCCACCTATGCCGCC
ACCTATTCCGCAGCTGCTCCCTTGGCCTACTCCGCTCCGGTTACCACCTA
CTCCGCACCATCATACTCCACCTACGCCGCTGCCGCCGTTCCCGCCTACA
CCGCCTACTCCGCCTTAAGTGCTCCTGCTTACACTGCTCCTGTGACCACA
TATGCCGCCGGAACTGCCTATGCTGCTCCCATCACCACCTACGCAGCTCC
CGCTGTCGTCAGCTCTTTCTTGAAGAAGAAGTAAAAGCTTTCTAGACCAT

BS23759.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:18:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG14377-RB 318 CG14377-PB 1..318 17..334 1575 99.7 Plus
CG14377-RA 318 CG14377-PA 1..318 17..334 1575 99.7 Plus
CG14374-RA 300 CG14374-PA 1..300 17..334 1210 92.8 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:18:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG14377-RB 363 CG14377-RB 31..351 15..335 1590 99.7 Plus
CG14377-RA 749 CG14377-RA 31..351 15..335 1590 99.7 Plus
CG14374-RA 447 CG14374-RA 31..333 15..335 1225 92.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:17:57
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 13397865..13398185 15..335 1590 99.7 Plus
3R 32079331 3R 13396808..13397110 335..15 1225 92.8 Minus
2R 25286936 2R 24415078..24415231 178..334 255 79 Plus
2R 25286936 2R 24414846..24414924 21..99 230 86.1 Plus
Blast to na_te.dros performed on 2014-11-26 15:17:59 has no hits.

BS23759.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-09 09:37:48 Download gff for BS23759.complete
Subject Subject Range Query Range Percent Splice Strand
CG14377-RA 33..348 17..332 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:59:10 Download gff for BS23759.complete
Subject Subject Range Query Range Percent Splice Strand
CG14377-RA 33..348 17..332 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:38:27 Download gff for BS23759.complete
Subject Subject Range Query Range Percent Splice Strand
CG14377-RA 33..348 17..332 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:38:27 Download gff for BS23759.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13397867..13398182 17..332 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:59:10 Download gff for BS23759.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 9223589..9223904 17..332 99   Plus

BS23759.pep Sequence

Translation from 16 to 333

> BS23759.pep
MKFLICLTLCIAAAQAGFIASPVATYAATYSAAAPLAYSAPVTTYSAPSY
STYAAAAVPAYTAYSALSAPAYTAPVTTYAAGTAYAAPITTYAAPAVVSS
FLKKK*

BS23759.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 19:09:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG14377-PB 105 CG14377-PB 1..105 1..105 522 100 Plus
CG14377-PA 105 CG14377-PA 1..105 1..105 522 100 Plus
CG14374-PA 99 CG14374-PA 1..99 1..105 466 92.4 Plus
CG45069-PB 129 CG45069-PB 1..129 1..105 371 66.7 Plus
CG45069-PA 129 CG45069-PA 1..129 1..105 371 66.7 Plus