Clone BS23808 Report

Search the DGRC for BS23808

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:238
Well:8
Vector:pDNR-Dual
Associated Gene/TranscriptLcp2-RA
Protein status:BS23808.pep: gold
Sequenced Size:437

Clone Sequence Records

BS23808.complete Sequence

437 bp assembled on 2011-01-27

GenBank Submission: KX802705

> BS23808.complete
GAAGTTATCAGTCGACATGTTCAAGTTTGTGATGATTCTCGCCGTTGTGG
GAGTGGCTACCGCCCTAGCCCCAGTTTCCCGCTCCGATGATGTACACGCT
GATGTCCTTTCCCGATCGGACGACGTTCGTGCCGACGGATTCGACTCCAG
CCTGCACACCTCAAACGGAATCGAGCAGGCCGCCAGCGGTGATGCCCATG
GCAACATCCACGGCAACTTCGGCTGGATCTCACCCGAGGGCGAGCACGTT
GAGGTAAAGTACGTCGCGAATGAAAACGGATACCAGCCCTCGGGAGCCTG
GATCCCCACTCCTCCTCCAATCCCAGAGGCCATCGCCCGCGCCGTTGCCT
GGCTGGAGTCTCACCCCCCAGCACCCGAGCACCCCCGTCATCACTAGAAG
CTTTCTAGACCATTCGTTTGGCGCGCGTTTTTTTTTA

BS23808.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:49:10
Subject Length Description Subject Range Query Range Score Percent Strand
Lcp2-RB 381 CG8697-PB 1..381 17..397 1905 100 Plus
Lcp2-RA 381 CG8697-PA 1..381 17..397 1905 100 Plus
Lcp1-RB 393 CG11650-PB 75..393 79..397 1310 94 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:49:11
Subject Length Description Subject Range Query Range Score Percent Strand
Lcp2-RB 927 CG8697-RB 243..633 7..397 1925 99.5 Plus
Lcp2-RA 540 CG8697-RA 33..423 7..397 1925 99.5 Plus
Lcp1-RB 1065 CG11650-RB 117..437 79..399 1320 94.1 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:49:08
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 8434091..8434459 397..29 1845 100 Minus
2R 25286936 2R 8430743..8431063 399..79 1320 94.1 Minus
Blast to na_te.dros performed on 2014-11-26 15:49:09 has no hits.

BS23808.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-28 16:05:06 Download gff for BS23808.complete
Subject Subject Range Query Range Percent Splice Strand
Lcp2-RA 48..427 22..402 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:45:19 Download gff for BS23808.complete
Subject Subject Range Query Range Percent Splice Strand
Lcp2-RA 48..427 22..402 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:04:25 Download gff for BS23808.complete
Subject Subject Range Query Range Percent Splice Strand
Lcp2-RA 48..427 22..402 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:04:25 Download gff for BS23808.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8434087..8434462 22..402 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:45:19 Download gff for BS23808.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 4321592..4321967 22..402 98   Minus

BS23808.pep Sequence

Translation from 16 to 396

> BS23808.pep
MFKFVMILAVVGVATALAPVSRSDDVHADVLSRSDDVRADGFDSSLHTSN
GIEQAASGDAHGNIHGNFGWISPEGEHVEVKYVANENGYQPSGAWIPTPP
PIPEAIARAVAWLESHPPAPEHPRHH*

BS23808.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:52:09
Subject Length Description Subject Range Query Range Score Percent Strand
Lcp2-PB 126 CG8697-PB 1..126 1..126 679 100 Plus
Lcp2-PA 126 CG8697-PA 1..126 1..126 679 100 Plus
Lcp1-PB 130 CG11650-PB 1..130 1..126 624 90 Plus
Lcp1-PA 130 CG11650-PA 1..130 1..126 624 90 Plus
Lcp4-PB 112 CG2044-PB 1..109 1..117 298 48.7 Plus