BS23815.complete Sequence
260 bp assembled on 2011-01-27
GenBank Submission: KX801621
> BS23815.complete
GAAGTTATCAGTCGACATGAAGCTGCTCGTTGTCGCCGTCATTGCGTGCA
TCATGCTCATCGGATTCGCCGATCCTGCCTCGGGCTGCAAGGATTGTTCA
TGCGTGATTTGTGGACCTGGTGGCGAGCCGTGTCCTGGGTGTTCCGCACG
GGTTCCCGTCTGCAAAGATCTGATCAACATTATGGAGGGTCTTGAGCGGC
AGGTGCGTCAGTGCGCCTGCGGAGAGCAGGTTTGGCTGTTCTAGAAGCTT
TCTAGACCAT
BS23815.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:49:26
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Sgs8-RA | 228 | CG6132-PA | 1..228 | 17..244 | 1140 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:49:27
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Sgs8-RA | 359 | CG6132-RA | 39..268 | 16..245 | 1150 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:49:24
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 11509058..11509259 | 245..44 | 1010 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-26 15:49:25 has no hits.
BS23815.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-28 16:05:06 Download gff for
BS23815.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sgs8-RA | 40..267 | 17..244 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:45:24 Download gff for
BS23815.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sgs8-RA | 40..267 | 17..244 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:04:30 Download gff for
BS23815.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sgs8-RA | 40..267 | 17..244 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:04:30 Download gff for
BS23815.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 11509059..11509258 | 45..244 | 100 | <- | Minus |
3L | 11509328..11509355 | 17..44 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:45:24 Download gff for
BS23815.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 11502159..11502358 | 45..244 | 100 | <- | Minus |
arm_3L | 11502428..11502455 | 17..44 | 100 | | Minus |
BS23815.pep Sequence
Translation from 16 to 243
> BS23815.pep
MKLLVVAVIACIMLIGFADPASGCKDCSCVICGPGGEPCPGCSARVPVCK
DLINIMEGLERQVRQCACGEQVWLF*
BS23815.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:52:11
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Sgs8-PA | 75 | CG6132-PA | 1..75 | 1..75 | 416 | 100 | Plus |
Sgs7-PA | 74 | CG18087-PA | 1..73 | 1..74 | 203 | 47.3 | Plus |
Sgs3-PA | 307 | CG11720-PA | 257..306 | 25..74 | 179 | 56 | Plus |