Clone BS23815 Report

Search the DGRC for BS23815

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:238
Well:15
Vector:pDNR-Dual
Associated Gene/TranscriptSgs8-RA
Protein status:BS23815.pep: gold
Sequenced Size:260

Clone Sequence Records

BS23815.complete Sequence

260 bp assembled on 2011-01-27

GenBank Submission: KX801621

> BS23815.complete
GAAGTTATCAGTCGACATGAAGCTGCTCGTTGTCGCCGTCATTGCGTGCA
TCATGCTCATCGGATTCGCCGATCCTGCCTCGGGCTGCAAGGATTGTTCA
TGCGTGATTTGTGGACCTGGTGGCGAGCCGTGTCCTGGGTGTTCCGCACG
GGTTCCCGTCTGCAAAGATCTGATCAACATTATGGAGGGTCTTGAGCGGC
AGGTGCGTCAGTGCGCCTGCGGAGAGCAGGTTTGGCTGTTCTAGAAGCTT
TCTAGACCAT

BS23815.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:49:26
Subject Length Description Subject Range Query Range Score Percent Strand
Sgs8-RA 228 CG6132-PA 1..228 17..244 1140 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:49:27
Subject Length Description Subject Range Query Range Score Percent Strand
Sgs8-RA 359 CG6132-RA 39..268 16..245 1150 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:49:24
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 11509058..11509259 245..44 1010 100 Minus
Blast to na_te.dros performed on 2014-11-26 15:49:25 has no hits.

BS23815.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-28 16:05:06 Download gff for BS23815.complete
Subject Subject Range Query Range Percent Splice Strand
Sgs8-RA 40..267 17..244 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:45:24 Download gff for BS23815.complete
Subject Subject Range Query Range Percent Splice Strand
Sgs8-RA 40..267 17..244 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:04:30 Download gff for BS23815.complete
Subject Subject Range Query Range Percent Splice Strand
Sgs8-RA 40..267 17..244 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:04:30 Download gff for BS23815.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11509059..11509258 45..244 100 <- Minus
3L 11509328..11509355 17..44 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:45:24 Download gff for BS23815.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 11502159..11502358 45..244 100 <- Minus
arm_3L 11502428..11502455 17..44 100   Minus

BS23815.pep Sequence

Translation from 16 to 243

> BS23815.pep
MKLLVVAVIACIMLIGFADPASGCKDCSCVICGPGGEPCPGCSARVPVCK
DLINIMEGLERQVRQCACGEQVWLF*

BS23815.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:52:11
Subject Length Description Subject Range Query Range Score Percent Strand
Sgs8-PA 75 CG6132-PA 1..75 1..75 416 100 Plus
Sgs7-PA 74 CG18087-PA 1..73 1..74 203 47.3 Plus
Sgs3-PA 307 CG11720-PA 257..306 25..74 179 56 Plus