Clone BS23930 Report

Search the DGRC for BS23930

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:239
Well:30
Vector:pDNR-Dual
Associated Gene/TranscriptCG7370-RA
Protein status:BS23930.pep: full length peptide match
Sequenced Size:257

Clone Sequence Records

BS23930.complete Sequence

257 bp assembled on 2011-01-28

GenBank Submission: KX805172

> BS23930.complete
GAAGTTATCAGTCGACATGCGACGTTGGCCCAAGTCAACACTTAACATTA
ACAAATGCCTTACTACAATACTGGTCGGCCAATTTGTTCTTTGCTTTTTG
TCTGGCGCTTTTCATTATTATTGTTTGTTTGGCGGCGACGGCGGCGCCCG
TAAAAAGCCGTTAGAAAAGCGGGAAGCTGAATTCGTTGGCGTTGGTAAGT
CGCGAAGCAAAAAAACGTACGAAAACGCACTTTTATTTTAAAAGCTTTCT
AGACCAT

BS23930.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:03:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG7370-RA 225 CG7370-PA 1..225 17..241 1125 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:03:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG7370-RA 1410 CG7370-RA 287..512 17..242 1130 100 Plus
Syn1-RD 3741 CG7152-RD 112..337 242..17 1130 100 Minus
Syn1-RC 3735 CG7152-RC 112..337 242..17 1130 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:03:33
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 21770198..21770423 17..242 1130 100 Plus
Blast to na_te.dros performed on 2014-11-26 16:03:34 has no hits.

BS23930.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-28 16:05:32 Download gff for BS23930.complete
Subject Subject Range Query Range Percent Splice Strand
CG7370-RA 287..509 17..239 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:51:22 Download gff for BS23930.complete
Subject Subject Range Query Range Percent Splice Strand
CG7370-RA 287..509 17..239 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:10:18 Download gff for BS23930.complete
Subject Subject Range Query Range Percent Splice Strand
Syn1-RC 115..337 17..239 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:10:18 Download gff for BS23930.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21770198..21770420 17..239 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:51:22 Download gff for BS23930.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 21763298..21763520 17..239 100   Plus

BS23930.pep Sequence

Translation from 16 to 240

> BS23930.pep
MRRWPKSTLNINKCLTTILVGQFVLCFLSGAFHYYCLFGGDGGARKKPLE
KREAEFVGVGKSRSKKTYENALLF*

BS23930.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:55:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG7370-PA 74 CG7370-PA 1..74 1..74 396 100 Plus