Clone BS23935 Report

Search the DGRC for BS23935

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:239
Well:35
Vector:pDNR-Dual
Associated Gene/TranscriptCG34317-RA
Protein status:BS23935.pep: gold
Sequenced Size:368

Clone Sequence Records

BS23935.complete Sequence

368 bp assembled on 2011-01-28

GenBank Submission: KX806417

> BS23935.complete
GAAGTTATCAGTCGACATGAGTGGTTACCAATATCTGGACGTGAAGATAA
AACTCCGTGATCCAGACTCCGTGACTCTGACGCCCGTATTCTTCTGTGGC
TGCATCCATAGCTCCTTGGCTAGTATTTTTGGCGAAATAGGTGGCCAGAC
CATACTGGAAATTGTGAAATTTAGTTCCAGCCAAAAACGCTCCATTCTCC
GGGTGCCCGAGAACGTCCTGGATCGCGTTCGCGTAGCTATAGCCCTAATA
GGATACTACCAGGAGGTGCCCTGCCATTTTCAGGTGCTCAGCACATCCCG
AAAGCCCTTGGATTTTGAGGAATCCCCCGAGGAGTTTGTAGCATTTAACT
AGAAGCTTTCTAGACCAT

BS23935.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:02:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG34317-RA 336 CG34317-PA 1..336 17..352 1680 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:02:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG7950-RA 1168 CG7950-RA 144..480 16..352 1685 100 Plus
CG34317-RA 1168 CG34317-RA 144..480 16..352 1685 100 Plus
CG7950-RB 1192 CG7950-RB 201..504 49..352 1520 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:02:43
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 30057140..30057443 49..352 1520 100 Plus
Blast to na_te.dros performed on 2014-11-26 16:02:44 has no hits.

BS23935.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-28 16:05:30 Download gff for BS23935.complete
Subject Subject Range Query Range Percent Splice Strand
CG34317-RA 151..486 17..352 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:51:03 Download gff for BS23935.complete
Subject Subject Range Query Range Percent Splice Strand
CG34317-RA 145..480 17..352 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:09:57 Download gff for BS23935.complete
Subject Subject Range Query Range Percent Splice Strand
CG34317-RA 145..480 17..352 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:09:57 Download gff for BS23935.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30057003..30057034 17..48 100 -> Plus
3R 30057140..30057443 49..352 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:51:03 Download gff for BS23935.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 25882725..25882756 17..48 100 -> Plus
arm_3R 25882862..25883165 49..352 100   Plus

BS23935.pep Sequence

Translation from 16 to 351

> BS23935.pep
MSGYQYLDVKIKLRDPDSVTLTPVFFCGCIHSSLASIFGEIGGQTILEIV
KFSSSQKRSILRVPENVLDRVRVAIALIGYYQEVPCHFQVLSTSRKPLDF
EESPEEFVAFN*

BS23935.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:55:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG34317-PA 111 CG34317-PA 1..111 1..111 568 100 Plus
CG15526-PA 112 CG15526-PA 1..107 1..109 283 51.4 Plus