Clone BS24039 Report

Search the DGRC for BS24039

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:240
Well:39
Vector:pDNR-Dual
Associated Gene/TranscriptCG34261-RA
Protein status:BS24039.pep: full length peptide match
Sequenced Size:254

Clone Sequence Records

BS24039.complete Sequence

254 bp assembled on 2011-01-28

GenBank Submission: KX800739

> BS24039.complete
GAAGTTATCAGTCGACATGGTAAATTTGCCTATTTTCCAGAAACAAATTT
GGACAGTTGTTGAATTTGCAGAGACAAAATGTTCAGCCAGGCGGCGTGGC
TGTCCTTCAGGACCAGCAGCGATTTATTTACTATCTGATCACCAAGAAAT
CCAGCTGGGGAAAGCCCACCTACGAACTTCTCCAGAGTTCCTTGATCGCC
ATGCGAAAACACATGGTATGTTTATGTATCTTCTATAAAAGCTTTCTAGA
CCAT

BS24039.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:08:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG34261-RB 447 CG34261-PB 122..297 40..215 880 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:08:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG34261-RB 796 CG34261-RB 187..362 40..215 880 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:08:55
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 21197047..21197268 17..238 1110 100 Plus
Blast to na_te.dros performed on 2014-11-26 16:08:56 has no hits.

BS24039.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-28 16:05:39 Download gff for BS24039.complete
Subject Subject Range Query Range Percent Splice Strand
CG34261-RA 201..420 17..236 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:53:26 Download gff for BS24039.complete
Subject Subject Range Query Range Percent Splice Strand
CG34261-RB 183..362 34..215 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:12:19 Download gff for BS24039.complete
Subject Subject Range Query Range Percent Splice Strand
CG34261-RB 183..362 34..215 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:12:19 Download gff for BS24039.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21197047..21197266 17..236 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:53:26 Download gff for BS24039.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 21190147..21190366 17..236 100   Plus

BS24039.pep Sequence

Translation from 16 to 237

> BS24039.pep
MVNLPIFQKQIWTVVEFAETKCSARRRGCPSGPAAIYLLSDHQEIQLGKA
HLRTSPEFLDRHAKTHGMFMYLL*
Sequence BS24039.pep has no blast hits.