BS24121.complete Sequence
344 bp assembled on 2011-01-28
GenBank Submission: KX802250
> BS24121.complete
GAAGTTATCAGTCGACATGGCCGACGAAACAGAGCAGCTCAGTCAGGTGA
TTTTGCCGGTAAAGGAGCCTTTGGATCTCATCCGATTGAGTTTAGATGAG
AAGGTGTACGTAAAGATGCGCAACGAGCGGGAACTGCGAGGACGTCTTCA
CGCCTTTGATCAACATTTGAACATGGTGCTCGGCGATGCGGAGGAGACGG
TGACCACTGTGGAGATCGACGAGGAGACCTATGAGGAGGTGTACAAGACC
GCCAAGCGCACTATTCCCATGCTATTCGTTAGAGGCGATGGAGTCATCCT
GGTTTCGCCACCCATGCGGGTGGGCTAGAAGCTTTCTAGACCAT
BS24121.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:39:55
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
LSm3-RB | 312 | CG31184-PB | 1..312 | 17..328 | 1545 | 99.7 | Plus |
LSm3-RA | 312 | CG31184-PA | 1..312 | 17..328 | 1545 | 99.7 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:39:56
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
LSm3-RB | 491 | CG31184-RB | 105..416 | 17..328 | 1545 | 99.7 | Plus |
LSm3-RA | 643 | CG31184-RA | 257..568 | 17..328 | 1545 | 99.7 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:39:53
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 23996766..23996942 | 152..328 | 870 | 99.4 | Plus |
3R | 32079331 | 3R | 23996588..23996706 | 34..152 | 595 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-26 16:39:54 has no hits.
BS24121.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-28 16:06:11 Download gff for
BS24121.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
LSm3-RA | 257..568 | 17..328 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:06:37 Download gff for
BS24121.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
LSm3-RA | 257..568 | 17..328 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:24:29 Download gff for
BS24121.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
LSm3-RA | 257..568 | 17..328 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:24:29 Download gff for
BS24121.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 23996518..23996538 | 17..37 | 100 | -> | Plus |
3R | 23996592..23996705 | 38..151 | 100 | -> | Plus |
3R | 23996766..23996942 | 152..328 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:06:37 Download gff for
BS24121.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 19822240..19822260 | 17..37 | 100 | -> | Plus |
arm_3R | 19822314..19822427 | 38..151 | 100 | -> | Plus |
arm_3R | 19822488..19822664 | 152..328 | 99 | | Plus |
BS24121.pep Sequence
Translation from 16 to 327
> BS24121.pep
MADETEQLSQVILPVKEPLDLIRLSLDEKVYVKMRNERELRGRLHAFDQH
LNMVLGDAEETVTTVEIDEETYEEVYKTAKRTIPMLFVRGDGVILVSPPM
RVG*
BS24121.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:56:03
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
LSm3-PB | 103 | CG31184-PB | 1..103 | 1..103 | 517 | 100 | Plus |
LSm3-PA | 103 | CG31184-PA | 1..103 | 1..103 | 517 | 100 | Plus |