Clone BS24126 Report

Search the DGRC for BS24126

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:241
Well:26
Vector:pDNR-Dual
Associated Gene/TranscriptCG32817-RA
Protein status:BS24126.pep: full length peptide match
Sequenced Size:398

Clone Sequence Records

BS24126.complete Sequence

398 bp assembled on 2011-01-28

GenBank Submission: KX803809

> BS24126.complete
GAAGTTATCAGTCGACATGCTTTTCGATGGCGCAACCGGCAATGGGCACG
GTCAGGGCCAGAATACCCTGAATCCATTGGGGCCAGGCCAGGAGGAGCCC
GCCCTATGCGAGCAGTACTATCTGCTGGGCGATGGTTCCATCATTCTGCG
CAACCATTCCATCGACTTGTCGAATCCGCCCCTGAAATCGCGCTGCTGCC
AGCTCCCAACACTCATCCACGACATATGCGTCAACTGCGTGATGGATCTC
TGCGAGGAGTGTGGCTACTCCTGCGGCGAGTGCGCCAAGTTTATTTGCCG
CAACTGCGTGACTTTATTTGGTAATCGAATTGAAGAAGAGGAGGCTCCGC
TGTGCGAGCACTGCCAGATGTTCCTCAGCTAGAAGCTTTCTAGACCAT

BS24126.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:41:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG32817-RB 366 CG32817-PB 1..366 17..382 1830 100 Plus
CG32817-RC 366 CG32817-PC 1..366 17..382 1830 100 Plus
CG32817-RA 366 CG32817-PA 1..366 17..382 1830 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:41:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG32817-RB 580 CG32817-RB 142..507 17..382 1830 100 Plus
CG32817-RC 837 CG32817-RC 399..764 17..382 1830 100 Plus
CG32817-RA 532 CG32817-RA 94..459 17..382 1830 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:41:13
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 479644..479945 17..318 1510 100 Plus
X 23542271 X 482132..482433 17..318 1480 99.3 Plus
X 23542271 X 477621..477931 17..318 1040 89.7 Plus
X 23542271 X 480030..480093 319..382 320 100 Plus
X 23542271 X 482518..482581 319..382 305 98.4 Plus
X 23542271 X 478013..478075 319..381 240 92.1 Plus
Blast to na_te.dros performed on 2014-11-26 16:41:15 has no hits.

BS24126.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-28 16:06:13 Download gff for BS24126.complete
Subject Subject Range Query Range Percent Splice Strand
CG32817-RB 127..492 17..382 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:07:09 Download gff for BS24126.complete
Subject Subject Range Query Range Percent Splice Strand
CG32817-RA 94..459 17..382 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:25:06 Download gff for BS24126.complete
Subject Subject Range Query Range Percent Splice Strand
CG32817-RA 94..459 17..382 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:25:06 Download gff for BS24126.complete
Subject Subject Range Query Range Percent Splice Strand
X 479644..479945 17..318 100 -> Plus
X 480030..480093 319..382 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:07:09 Download gff for BS24126.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 373677..373978 17..318 100 -> Plus
arm_X 374063..374126 319..382 100   Plus

BS24126.pep Sequence

Translation from 16 to 381

> BS24126.pep
MLFDGATGNGHGQGQNTLNPLGPGQEEPALCEQYYLLGDGSIILRNHSID
LSNPPLKSRCCQLPTLIHDICVNCVMDLCEECGYSCGECAKFICRNCVTL
FGNRIEEEEAPLCEHCQMFLS*

BS24126.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:56:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG32817-PB 121 CG32817-PB 1..121 1..121 683 100 Plus
CG32817-PC 121 CG32817-PC 1..121 1..121 683 100 Plus
CG32817-PA 121 CG32817-PA 1..121 1..121 683 100 Plus
CG3176-PD 121 CG3176-PD 1..121 1..121 664 97.5 Plus
CG3176-PA 121 CG3176-PA 1..121 1..121 664 97.5 Plus