Clone BS24132 Report

Search the DGRC for BS24132

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:241
Well:32
Vector:pDNR-Dual
Associated Gene/TranscriptCG32368-RA
Protein status:BS24132.pep: full length peptide match
Sequenced Size:299

Clone Sequence Records

BS24132.complete Sequence

299 bp assembled on 2011-01-28

GenBank Submission: KX806425

> BS24132.complete
GAAGTTATCAGTCGACATGGATGGTGCCATTGCAATGAATCATGTGGTGG
AATCCGACAAGGAGAAGAGGCAATTTAAACTGAAAATTATGGAGCTCGAG
CACGAAATGAGGATGGAAAAGGATCCAGCTCGCGCCAAGATGATCGAGGA
GCACATTGAGAAATTGAAGAAACTGGATGAGGAGAACCAAAAGCGGAACT
TGGAAATTGCCAAGGCAAACGTGATGTTAATGACAGCGAATACAAAGTTT
AGAGTGGGTTATCATATTATTAACAACCTTTAAAAGCTTTCTAGACCAT

BS24132.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:43:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG32368-RA 267 CG32368-PA 1..267 17..283 1335 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:43:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG32368-RA 410 CG32368-RA 57..324 17..284 1340 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:43:44
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 7915493..7915760 17..284 1340 100 Plus
Blast to na_te.dros performed on 2014-11-26 16:43:45 has no hits.

BS24132.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-28 16:06:17 Download gff for BS24132.complete
Subject Subject Range Query Range Percent Splice Strand
CG32368-RA 57..321 17..281 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:08:13 Download gff for BS24132.complete
Subject Subject Range Query Range Percent Splice Strand
CG32368-RA 57..321 17..281 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:26:02 Download gff for BS24132.complete
Subject Subject Range Query Range Percent Splice Strand
CG32368-RA 57..321 17..281 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:26:02 Download gff for BS24132.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7915493..7915757 17..281 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:08:13 Download gff for BS24132.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 7908593..7908857 17..281 100   Plus

BS24132.pep Sequence

Translation from 16 to 282

> BS24132.pep
MDGAIAMNHVVESDKEKRQFKLKIMELEHEMRMEKDPARAKMIEEHIEKL
KKLDEENQKRNLEIAKANVMLMTANTKFRVGYHIINNL*

BS24132.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:56:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG32368-PA 88 CG32368-PA 1..88 1..88 445 100 Plus