Clone BS24238 Report

Search the DGRC for BS24238

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:242
Well:38
Vector:pDNR-Dual
Associated Gene/TranscriptCG17490-RD
Protein status:BS24238.pep: full length peptide match
Sequenced Size:344

Clone Sequence Records

BS24238.complete Sequence

344 bp assembled on 2011-01-28

GenBank Submission: KX802522

> BS24238.complete
GAAGTTATCAGTCGACATGGAAAGGAAACCAAGTATACCAAAAATCAGGC
AGGTCAGCAGTCTTGGAAGTCAATTCACTTTTCCCAATATAGCGGATCTA
TTTTGCAATGCCGTCTCCATTCACAATGACTATTGTAAATTGCATTTTAT
AAACGAAAAGTTGCAATTCCATTTAAATGGAATGTTGGAAAGTAAAGATG
CTTCAGCGATTTACTATTTTAAGCAACATATTATTCTAAACTCGGATCAA
CTGGAATCTGCATCCAAAAATTATGACATGACCTTTCATACAATAATGAG
AAGGTGGGAAACTGACCGGAAAACGTAAAAGCTTTCTAGACCAT

BS24238.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:50:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG17490-RC 405 CG17490-PC 94..405 17..328 1560 100 Plus
CG17490-RD 312 CG17490-PD 1..312 17..328 1560 100 Plus
CG17490-RF 393 CG17490-PF 1..284 17..300 1420 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:50:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG17490-RC 1394 CG17490-RC 217..529 17..329 1565 100 Plus
CG17490-RD 1342 CG17490-RD 149..461 17..329 1565 100 Plus
CG17490-RF 2953 CG17490-RF 1756..2039 17..300 1420 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:50:10
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 22540043..22540324 17..298 1410 100 Plus
Blast to na_te.dros performed 2014-11-26 16:50:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dkoe\Gandalf 979 Dkoe\Gandalf DK29466 979bp Derived from U29466 (Rel. 63, Last updated, Version 5). 42..82 179..138 108 76.2 Minus

BS24238.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-28 16:06:26 Download gff for BS24238.complete
Subject Subject Range Query Range Percent Splice Strand
CG17490-RD 147..456 17..326 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:10:56 Download gff for BS24238.complete
Subject Subject Range Query Range Percent Splice Strand
CG17490-RD 147..456 17..326 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:28:31 Download gff for BS24238.complete
Subject Subject Range Query Range Percent Splice Strand
CG17490-RD 149..458 17..326 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:28:31 Download gff for BS24238.complete
Subject Subject Range Query Range Percent Splice Strand
2L 22540043..22540324 17..298 100 -> Plus
2L 22547540..22547567 299..326 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:10:56 Download gff for BS24238.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 22432775..22433056 17..298 100 -> Plus
arm_2L 22440272..22440299 299..326 100   Plus

BS24238.pep Sequence

Translation from 16 to 327

> BS24238.pep
MERKPSIPKIRQVSSLGSQFTFPNIADLFCNAVSIHNDYCKLHFINEKLQ
FHLNGMLESKDASAIYYFKQHIILNSDQLESASKNYDMTFHTIMRRWETD
RKT*

BS24238.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:56:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG17490-PD 103 CG17490-PD 1..103 1..103 546 100 Plus
CG17490-PC 134 CG17490-PC 32..134 1..103 546 100 Plus
CG17490-PF 130 CG17490-PF 1..94 1..94 494 100 Plus
CG17490-PA 130 CG17490-PA 1..94 1..94 494 100 Plus
CG17490-PG 707 CG17490-PG 578..671 1..94 494 100 Plus