BS24259.complete Sequence
248 bp assembled on 2011-01-28
GenBank Submission: KX805189
> BS24259.complete
GAAGTTATCAGTCGACATGTGCGACTACCAGATGGAGTACTCCTTTATTT
TTGAAGACAGCTCCTGCGAGGGCGATGCCTCGATGGCATCCTACGACAAT
GGATTCGAGTCCATGTGGCATCAAGTGCGCGAGGAGTTGCAAAGGGAGCG
GGAGATGAATGAGCTCTGCCAGGTTTTCCAGCAAAACTTGAGCCTGAGTC
CGCCGGTCATCGCGGATAGATGGAGATTCTGAAAGCTTTCTAGACCAT
BS24259.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:35:57
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
pgc-RD | 216 | CG32885-PD | 1..216 | 17..232 | 1080 | 100 | Plus |
pgc-RA | 216 | CG32885-PA | 1..216 | 17..232 | 1080 | 100 | Plus |
pgc-RC | 216 | CG32885-PC | 1..216 | 17..232 | 1080 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:35:59
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
pgc-RD | 643 | CG32885-RD | 27..242 | 17..232 | 1080 | 100 | Plus |
pgc-RA | 1211 | CG32885-RA | 595..810 | 17..232 | 1080 | 100 | Plus |
pgc-RC | 686 | CG32885-RC | 70..285 | 17..232 | 1080 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:35:55
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 22332197..22332412 | 17..232 | 1080 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-26 16:35:56 has no hits.
BS24259.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-28 16:06:04 Download gff for
BS24259.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
pgc-RA | 549..763 | 17..231 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:04:55 Download gff for
BS24259.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
pgc-RC | 70..284 | 17..231 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:22:54 Download gff for
BS24259.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
pgc-RC | 70..284 | 17..231 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:22:54 Download gff for
BS24259.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 22332197..22332411 | 17..231 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:04:55 Download gff for
BS24259.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 18219702..18219916 | 17..231 | 100 | | Plus |
BS24259.pep Sequence
Translation from 16 to 231
> BS24259.pep
MCDYQMEYSFIFEDSSCEGDASMASYDNGFESMWHQVREELQREREMNEL
CQVFQQNLSLSPPVIADRWRF*
BS24259.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:55:47
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
pgc-PD | 71 | CG32885-PD | 1..71 | 1..71 | 387 | 100 | Plus |
pgc-PA | 71 | CG32885-PA | 1..71 | 1..71 | 387 | 100 | Plus |
pgc-PC | 71 | CG32885-PC | 1..71 | 1..71 | 387 | 100 | Plus |
CG34207-PA | 101 | CG34207-PA | 3..82 | 7..59 | 138 | 42.5 | Plus |