Clone BS24259 Report

Search the DGRC for BS24259

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:242
Well:59
Vector:pDNR-Dual
Associated Gene/Transcriptpgc-RA
Protein status:BS24259.pep: full length peptide match
Sequenced Size:248

Clone Sequence Records

BS24259.complete Sequence

248 bp assembled on 2011-01-28

GenBank Submission: KX805189

> BS24259.complete
GAAGTTATCAGTCGACATGTGCGACTACCAGATGGAGTACTCCTTTATTT
TTGAAGACAGCTCCTGCGAGGGCGATGCCTCGATGGCATCCTACGACAAT
GGATTCGAGTCCATGTGGCATCAAGTGCGCGAGGAGTTGCAAAGGGAGCG
GGAGATGAATGAGCTCTGCCAGGTTTTCCAGCAAAACTTGAGCCTGAGTC
CGCCGGTCATCGCGGATAGATGGAGATTCTGAAAGCTTTCTAGACCAT

BS24259.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:35:57
Subject Length Description Subject Range Query Range Score Percent Strand
pgc-RD 216 CG32885-PD 1..216 17..232 1080 100 Plus
pgc-RA 216 CG32885-PA 1..216 17..232 1080 100 Plus
pgc-RC 216 CG32885-PC 1..216 17..232 1080 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:35:59
Subject Length Description Subject Range Query Range Score Percent Strand
pgc-RD 643 CG32885-RD 27..242 17..232 1080 100 Plus
pgc-RA 1211 CG32885-RA 595..810 17..232 1080 100 Plus
pgc-RC 686 CG32885-RC 70..285 17..232 1080 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:35:55
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 22332197..22332412 17..232 1080 100 Plus
Blast to na_te.dros performed on 2014-11-26 16:35:56 has no hits.

BS24259.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-28 16:06:04 Download gff for BS24259.complete
Subject Subject Range Query Range Percent Splice Strand
pgc-RA 549..763 17..231 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:04:55 Download gff for BS24259.complete
Subject Subject Range Query Range Percent Splice Strand
pgc-RC 70..284 17..231 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:22:54 Download gff for BS24259.complete
Subject Subject Range Query Range Percent Splice Strand
pgc-RC 70..284 17..231 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:22:54 Download gff for BS24259.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22332197..22332411 17..231 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:04:55 Download gff for BS24259.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 18219702..18219916 17..231 100   Plus

BS24259.pep Sequence

Translation from 16 to 231

> BS24259.pep
MCDYQMEYSFIFEDSSCEGDASMASYDNGFESMWHQVREELQREREMNEL
CQVFQQNLSLSPPVIADRWRF*

BS24259.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:55:47
Subject Length Description Subject Range Query Range Score Percent Strand
pgc-PD 71 CG32885-PD 1..71 1..71 387 100 Plus
pgc-PA 71 CG32885-PA 1..71 1..71 387 100 Plus
pgc-PC 71 CG32885-PC 1..71 1..71 387 100 Plus
CG34207-PA 101 CG34207-PA 3..82 7..59 138 42.5 Plus