Clone BS24290 Report

Search the DGRC for BS24290

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:242
Well:90
Vector:pDNR-Dual
Associated Gene/TranscriptCG5928-RB
Protein status:BS24290.pep: full length peptide match
Sequenced Size:269

Clone Sequence Records

BS24290.complete Sequence

269 bp assembled on 2011-01-28

GenBank Submission: KX802421

> BS24290.complete
GAAGTTATCAGTCGACATGCTGCAACTTCAAAAGATGAATACTCTGCTGC
TGCTCTTGGCCATGATGCGCTGCATCTGTGCCACGCCCATAGCTCCTGCC
ACGCCCGATGGCGCCACGCCCATCGACGCCCGCGTCTCGGCCGCCGACTT
CGGAGCCCAGGATGCTTTCGATGCCGCCGACAGCTCCGCGGAATCCACCC
ACGCGCAGGCCAGCGACGCCGGGTTCAAGGTGAGTAACCGAGGTATACTT
TAAAAGCTTTCTAGACCAT

BS24290.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:36:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG5928-RB 237 CG5928-PB 1..237 17..253 1185 100 Plus
CG5928-RC 600 CG5928-PC 1..213 17..229 1065 100 Plus
CG5928-RA 552 CG5928-PA 1..213 17..229 1065 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:36:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG5928-RB 863 CG5928-RB 134..372 17..255 1195 100 Plus
CG5928-RC 1182 CG5928-RC 134..346 17..229 1065 100 Plus
CG5928-RA 806 CG5928-RA 134..346 17..229 1065 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:36:01
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 6068091..6068329 17..255 1195 100 Plus
Blast to na_te.dros performed on 2014-11-26 16:36:02 has no hits.

BS24290.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-28 16:06:05 Download gff for BS24290.complete
Subject Subject Range Query Range Percent Splice Strand
CG5928-RB 132..366 17..251 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:04:56 Download gff for BS24290.complete
Subject Subject Range Query Range Percent Splice Strand
CG5928-RB 132..366 17..251 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:22:56 Download gff for BS24290.complete
Subject Subject Range Query Range Percent Splice Strand
CG5928-RB 134..368 17..251 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:22:56 Download gff for BS24290.complete
Subject Subject Range Query Range Percent Splice Strand
X 6068091..6068325 17..251 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:04:56 Download gff for BS24290.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 5962124..5962358 17..251 100   Plus

BS24290.pep Sequence

Translation from 16 to 252

> BS24290.pep
MLQLQKMNTLLLLLAMMRCICATPIAPATPDGATPIDARVSAADFGAQDA
FDAADSSAESTHAQASDAGFKVSNRGIL*

BS24290.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:55:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG5928-PB 78 CG5928-PB 1..78 1..78 389 100 Plus
CG5928-PA 183 CG5928-PA 1..73 1..73 363 98.6 Plus
CG5928-PC 199 CG5928-PC 1..73 1..73 363 98.6 Plus