Clone BS24390 Report

Search the DGRC for BS24390

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:243
Well:90
Vector:pDNR-Dual
Associated Gene/TranscriptCpr67Fa1-RA
Protein status:BS24390.pep: gold
Sequenced Size:456

Clone Sequence Records

BS24390.complete Sequence

456 bp assembled on 2011-02-01

GenBank Submission: KX805033

> BS24390.complete
GAAGTTATCAGTCGACATGTTCCGCTACCTGCTCGTCGCCTCCGCTATCC
TGGCCTGCGCCTACGGTGCCGCCACCTACAACCAGGAAGCTGGTGCCTAC
ATCACAAAGATCGGTTCCGACATCCAGCCCGAGGGCAACTACAACTACCA
ATACGAGACCAGCAACGGCATCGCCGCCCAGGAGTCCGGAATTGGAGGAA
ACCACGCCAACGGAGGCTTCTCGTGGTACTCGCCCGAGGGTGAGCTCGTC
CAGATCTCGTACGTGGCCGACGAGAACGGTTACCAGCCCCAGGGAGCTCT
CCTGCCCACTCCTCCTCCAATCCCAGCTGCCATCCTTAGGAGCTTGGAGT
ACATCCGCACCCATCCCCAATACGTCGAGCAGGAGTACCGCAGGCCCGCC
CTCAGGAAGGTCTTTGGTTAAAAGCTTTCTAGTCCATTCGTTGGGCCCTT
AAACGA

BS24390.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:18:21
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr67Fa1-RA 405 CG7941-PA 1..405 17..421 2010 99.8 Plus
Cpr67Fa2-RA 405 CG18349-PA 1..405 17..421 1800 96.3 Plus
Lcp4-RB 339 CG2044-PB 225..296 265..336 255 90.3 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:18:23
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr67Fa1-RA 554 CG7941-RA 60..464 17..421 2010 99.8 Plus
Cpr67Fa2-RA 565 CG18349-RA 45..459 7..421 1805 95.7 Plus
Lcp4-RB 527 CG2044-RB 274..345 265..336 255 90.3 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:18:19
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 10890218..10890610 29..421 1950 99.7 Plus
3L 28110227 3L 10892019..10892410 30..421 1750 96.4 Plus
2R 25286936 2R 8437977..8438048 265..336 255 90.3 Plus
2R 25286936 2R 8435769..8435840 265..336 240 88.9 Plus
3L 28110227 3L 7093638..7093705 302..369 205 86.8 Plus
2R 25286936 2R 8430808..8430913 334..229 200 79.2 Minus
Blast to na_te.dros performed on 2014-11-26 15:18:20 has no hits.

BS24390.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-09 09:37:48 Download gff for BS24390.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr67Fa1-RA 58..459 22..425 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:59:13 Download gff for BS24390.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr67Fa1-RA 65..466 22..425 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:38:34 Download gff for BS24390.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr67Fa1-RA 65..466 22..425 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:38:34 Download gff for BS24390.complete
Subject Subject Range Query Range Percent Splice Strand
3L 10890215..10890612 26..425 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:59:13 Download gff for BS24390.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 10883315..10883712 26..425 99   Plus

BS24390.pep Sequence

Translation from 16 to 420

> BS24390.pep
MFRYLLVASAILACAYGAATYNQEAGAYITKIGSDIQPEGNYNYQYETSN
GIAAQESGIGGNHANGGFSWYSPEGELVQISYVADENGYQPQGALLPTPP
PIPAAILRSLEYIRTHPQYVEQEYRRPALRKVFG*

BS24390.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 19:09:02
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr67Fa1-PA 134 CG7941-PA 1..134 1..134 710 100 Plus
Cpr67Fa2-PA 134 CG18349-PA 1..134 1..134 704 97.8 Plus
Cpr65Ec-PA 127 CG8634-PA 4..117 2..118 335 53.8 Plus
Cpr65Eb-PA 179 CG8638-PA 8..122 5..118 312 52.2 Plus
Cpr67Fb-PA 122 CG18348-PA 1..114 1..117 296 50.4 Plus