BS24485.complete Sequence
266 bp assembled on 2011-02-01
GenBank Submission: KX803164
> BS24485.complete
GAAGTTATCAGTCGACATGTCCGCCTACAAGCTGGAGACCGCCCCGTTCG
ACCCACGGTTCCCTAACCAGAACGTGACCCGCTACTGCTACCAGTCGTAC
ATCGACTTCCACCGCTGCCAGAAGAAGCGCGGCGAGGACTTCGCGCCCTG
CAACTACTTCCAGAAGGTCTACAAGTCGATGTGCCCCAACGCCTGGGTGG
AGAAGTGGGACGACCAGCGCGAGAGCGGCACATTCCCCGGCCGCATCTAA
AAGCTTTCTAGACCAT
BS24485.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:58:02
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CoVIb-RA | 291 | CG14235-PA | 56..291 | 15..250 | 1180 | 100 | Plus |
| CoVIb-RD | 234 | CG14235-PD | 1..234 | 17..250 | 1170 | 100 | Plus |
| CoVIb-RB | 234 | CG14235-PB | 1..234 | 17..250 | 1170 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:58:03
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CoVIb-RD | 678 | CG14235-RD | 73..308 | 15..250 | 1180 | 100 | Plus |
| CoVIb-RB | 554 | CG14235-RB | 98..333 | 15..250 | 1180 | 100 | Plus |
| CoVIb-RC | 706 | CG14235-RC | 101..336 | 15..250 | 1180 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 21:58:00
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| X | 23542271 | X | 19740907..19741142 | 250..15 | 1180 | 100 | Minus |
Blast to na_te.dros performed 2014-11-26 21:58:01
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| R1A1-element | 5356 | R1A1-element DMRER1DM 5356bp Derived from X51968 (g8429) (Rel. 23, Last updated, Version 1). | 622..706 | 31..120 | 105 | 61.1 | Plus |
BS24485.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-02-01 16:02:14 Download gff for
BS24485.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG14235-RA | 140..371 | 17..248 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:42:19 Download gff for
BS24485.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CoVIb-RC | 106..337 | 17..248 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:47:12 Download gff for
BS24485.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CoVIb-RC | 103..334 | 17..248 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:47:12 Download gff for
BS24485.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| X | 19740909..19741140 | 17..248 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:42:19 Download gff for
BS24485.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_X | 19634942..19635173 | 17..248 | 100 | | Minus |
BS24485.pep Sequence
Translation from 16 to 249
> BS24485.pep
MSAYKLETAPFDPRFPNQNVTRYCYQSYIDFHRCQKKRGEDFAPCNYFQK
VYKSMCPNAWVEKWDDQRESGTFPGRI*
BS24485.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 19:00:03
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CoVIb-PD | 77 | CG14235-PD | 1..77 | 1..77 | 444 | 100 | Plus |
| CoVIb-PB | 77 | CG14235-PB | 1..77 | 1..77 | 444 | 100 | Plus |
| CoVIb-PC | 77 | CG14235-PC | 1..77 | 1..77 | 444 | 100 | Plus |
| CoVIb-PA | 96 | CG14235-PA | 20..96 | 1..77 | 444 | 100 | Plus |
