Clone BS24486 Report

Search the DGRC for BS24486

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:244
Well:86
Vector:pDNR-Dual
Associated Gene/TranscriptCG42457-RA
Protein status:BS24486.pep: full length peptide match
Sequenced Size:749

Clone Sequence Records

BS24486.complete Sequence

749 bp assembled on 2011-02-01

GenBank Submission: KX805320

> BS24486.complete
GAAGTTATCAGTCGACATGGCAACAGCAACTGGCTCAAGCTGCTCCACCA
GTAACGGCAGTGGCAGCAGCAGCAACAGCAACCACAACAGCGCTGCGGTG
CAGCAACATCCGGTGGCATTCATCGAGTTCAAGGACCCACCGACCGCGTC
TCAGGCCATGCAGCAGCTGCAGGGTAAATATCTGCTCAGCTCCGATCGCG
GTTCCATCCGCATCGAGTTTGCGCGCAGCAAAATGATCAACGAGGTGACC
ATAATGAACACCAAGGCACCGCCACCACCACCACCCACTGCTGTTGCTGC
TACTGTTGCACCACCGCCACCGCCAGCACCCATGTACATCCTGAACGGCG
GTGGGGGGGTCGAGCATTTGCTGGTCCCAGCACCACCGCCGTCGGCACAG
CAGCAGCAGCAGCAGCAGCAGCAGCAACTCCAGATGCAGCAACTGCAACA
GCAGATGCACCTGCAGCAGCAACATCAACAGCAGCAGCAACTCCAATTGA
CCGTGGCAGCACCCTGCACTGCAGCAAGCACCACCACCCACAGCAGCACC
ACTAGCGTTGTTGTTAACTCACTACAGCACCACCAACTTCATCATCCAAA
TCAGCACCACCAAAATCATCTCTTTAGAGACCAACAGCAGCAGCATCAAC
AGCAAGCAACAATCAAGCAACAATCAGCAACAACAAAGGAGCGGGTATGG
AATCACGGCATGATTTGCTCGCTAAAAAGCTAGAAGCTTTCTAGACCAT

BS24486.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:58:19
Subject Length Description Subject Range Query Range Score Percent Strand
cpo-RS 2909 CG43738-PS 2247..2862 16..631 3080 100 Plus
cpo-RQ 2289 CG43738-PQ 2208..2289 632..713 410 100 Plus
cpo-RP 2526 CG43738-PP 2208..2255 687..734 240 100 Plus
cpo-RS 2909 CG43738-PS 2863..2909 687..733 235 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:58:20
Subject Length Description Subject Range Query Range Score Percent Strand
cpo-RR 7247 CG43738-RR 3945..4663 16..734 3595 100 Plus
cpo-RY 6131 CG43738-RY 2831..3547 16..734 3530 99.7 Plus
cpo-RX 6116 CG43738-RX 2869..3484 16..631 3080 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 21:58:15
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 18011098..18011713 16..631 3080 100 Plus
3R 32079331 3R 18013148..18013195 687..734 240 100 Plus
Blast to na_te.dros performed 2014-11-26 21:58:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2330..2987 20..655 318 56.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2363..2971 20..618 312 56.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2740..2984 437..686 282 62 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2766..2990 393..619 275 61 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2307..2923 49..688 254 54.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2781..2959 371..557 248 63.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6736..7210 20..501 202 56.7 Plus
I-element 5371 I-element DMIFACA 5371bp Derived from M14954 (g157749) (Rel. 44, Last updated, Version 2). 1124..1244 567..685 193 66.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6835..6934 20..121 162 67.3 Plus
roo 9092 roo DM_ROO 9092bp 1069..1164 20..114 161 67 Plus
roo 9092 roo DM_ROO 9092bp 1093..1163 20..91 159 70.8 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6763..6836 20..91 158 70.3 Plus
roo 9092 roo DM_ROO 9092bp 1079..1151 21..91 153 71.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6737..6802 46..112 152 73.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2762..2853 20..110 150 66.7 Plus
roo 9092 roo DM_ROO 9092bp 1037..1141 10..112 150 62.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6723..7212 53..559 146 54.3 Plus
Dvir\Het-A 6610 Dvir\Het-A HETAVIR 6610bp 3270..3344 36..112 146 70.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6817..6887 20..91 141 68.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6784..6857 20..91 140 67.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2603..3005 20..460 136 53.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2798..2889 20..110 133 64.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1520..1584 20..82 131 69.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1518..1584 24..91 130 67.6 Plus
roo 9092 roo DM_ROO 9092bp 1052..1129 38..112 120 66.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1516..1589 44..118 111 64.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2764..2828 47..112 111 67.2 Plus
Dmer\R1A3 3772 Dmer\R1A3 MERCR1A3 3772bp 662..727 104..38 107 64.2 Minus

BS24486.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-02-01 16:02:15 Download gff for BS24486.complete
Subject Subject Range Query Range Percent Splice Strand
cpo-RB 2758..3474 17..733 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:42:26 Download gff for BS24486.complete
Subject Subject Range Query Range Percent Splice Strand
cpo-RN 2832..3548 17..733 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:47:20 Download gff for BS24486.complete
Subject Subject Range Query Range Percent Splice Strand
cpo-RR 3946..4662 17..733 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:47:20 Download gff for BS24486.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18013148..18013194 687..733 100   Plus
3R 18011099..18011713 17..631 100 -> Plus
3R 18012096..18012150 632..686 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:42:26 Download gff for BS24486.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 13836821..13837435 17..631 100 -> Plus
arm_3R 13837818..13837872 632..686 100 -> Plus
arm_3R 13838870..13838916 687..733 100   Plus

BS24486.pep Sequence

Translation from 16 to 732

> BS24486.pep
MATATGSSCSTSNGSGSSSNSNHNSAAVQQHPVAFIEFKDPPTASQAMQQ
LQGKYLLSSDRGSIRIEFARSKMINEVTIMNTKAPPPPPPTAVAATVAPP
PPPAPMYILNGGGGVEHLLVPAPPPSAQQQQQQQQQQLQMQQLQQQMHLQ
QQHQQQQQLQLTVAAPCTAASTTTHSSTTSVVVNSLQHHQLHHPNQHHQN
HLFRDQQQQHQQQATIKQQSATTKERVWNHGMICSLKS*

BS24486.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 19:00:13
Subject Length Description Subject Range Query Range Score Percent Strand
cpo-PS 962 CG43738-PS 750..955 1..206 1073 99.5 Plus
velo-PC 1833 CG10107-PC 50..153 91..227 164 36.7 Plus
velo-PA 1833 CG10107-PA 50..153 91..227 164 36.7 Plus
ct-PD 2165 CG11387-PD 565..706 95..231 163 33.1 Plus
ct-PC 2383 CG11387-PC 783..924 95..231 163 33.1 Plus