BS24547.complete Sequence
227 bp assembled on 2011-08-23
GenBank Submission: KX802096
> BS24547.complete
GAAGTTATCAGTCGACATGGACAAGCCTCAGTACGCTCGCGTGGTCGAGA
TCCTTGGACGCACTGGATCCCAAGGGCAGTGCACCCAGGTGCGGGTGGAG
TTCCTCGGCGACCAAAGCCGCCAGATTATTCGGAATGTCAAAGGACCTGT
TCGCGTGGGCGACATCCTGTCGCTGCTGGAAACTGAACGCGAGGCCAGGA
GACTGCGCTGAAAGCTTTCTAGACCAT
BS24547.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:59:25
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| RpS28a-RA | 195 | CG15527-PA | 1..195 | 17..211 | 975 | 100 | Plus |
| RpS28b-RB | 198 | CG2998-PB | 46..196 | 59..209 | 335 | 81.5 | Plus |
| RpS28b-RA | 198 | CG2998-PA | 46..196 | 59..209 | 335 | 81.5 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:59:27
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| RpS28a-RA | 304 | CG15527-RA | 50..245 | 16..211 | 980 | 100 | Plus |
| RpS28b-RB | 972 | CG2998-RB | 133..283 | 59..209 | 335 | 81.5 | Plus |
| RpS28b-RA | 520 | CG2998-RA | 133..283 | 59..209 | 335 | 81.5 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 06:59:24
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 3R | 32079331 | 3R | 30022404..30022599 | 211..16 | 980 | 100 | Minus |
| X | 23542271 | X | 9554755..9554905 | 59..209 | 335 | 81.5 | Plus |
Blast to na_te.dros performed on 2014-11-27 06:59:25 has no hits.
BS24547.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-23 17:56:41 Download gff for
BS24547.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| RpS28a-RA | 1..194 | 17..210 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:01:35 Download gff for
BS24547.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| RpS28a-RA | 51..244 | 17..210 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:00:03 Download gff for
BS24547.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| RpS28a-RA | 51..244 | 17..210 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 08:00:03 Download gff for
BS24547.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 3R | 30022405..30022598 | 17..210 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:01:35 Download gff for
BS24547.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_3R | 25848127..25848320 | 17..210 | 100 | | Minus |
BS24547.pep Sequence
Translation from 16 to 210
> BS24547.pep
MDKPQYARVVEILGRTGSQGQCTQVRVEFLGDQSRQIIRNVKGPVRVGDI
LSLLETEREARRLR*
BS24547.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:20:09
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| RpS28a-PA | 64 | CG15527-PA | 1..64 | 1..64 | 319 | 100 | Plus |
| RpS28b-PB | 65 | CG2998-PB | 1..65 | 1..64 | 264 | 81.5 | Plus |
| RpS28b-PA | 65 | CG2998-PA | 1..65 | 1..64 | 264 | 81.5 | Plus |
| RpS28-like-PA | 76 | CG34182-PA | 9..59 | 7..57 | 128 | 49 | Plus |
