Clone BS24561 Report

Search the DGRC for BS24561

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:245
Well:61
Vector:pDNR-Dual
Associated Gene/Transcriptng4-RA
Protein status:BS24561.pep: full length peptide match
Sequenced Size:206

Clone Sequence Records

BS24561.complete Sequence

206 bp assembled on 2011-06-21

GenBank Submission: KX806361

> BS24561.complete
GAAGTTATCAGTCGACATGGAATGGAAACTGCTGCTAATAGTCCTGCCCT
GGCTGCTCGTATGTAAAATTTTTTATAAGGTCGAGGACTTTACGGAGCCT
GATGTCGCTTACCAAAGCATTGACTATCATCCCGAGGACTACATCGATTC
CTTCACCGACTTTCAGAAGCATGACTACTTTCAGTATTGAAAGCTTTCTA
GACCAT

BS24561.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:13:56
Subject Length Description Subject Range Query Range Score Percent Strand
ng4-RA 174 CG10789-PA 1..174 17..190 870 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:13:57
Subject Length Description Subject Range Query Range Score Percent Strand
ng4-RA 267 CG10789-RA 33..206 17..190 870 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:13:54
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 3244015..3244188 190..17 870 100 Minus
Blast to na_te.dros performed on 2014-11-26 15:13:55 has no hits.

BS24561.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-06-21 10:29:21 Download gff for BS24561.complete
Subject Subject Range Query Range Percent Splice Strand
ng4-RA 1..173 17..189 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:50:02 Download gff for BS24561.complete
Subject Subject Range Query Range Percent Splice Strand
ng4-RA 33..205 17..189 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:09:09 Download gff for BS24561.complete
Subject Subject Range Query Range Percent Splice Strand
ng4-RA 33..205 17..189 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:09:09 Download gff for BS24561.complete
Subject Subject Range Query Range Percent Splice Strand
X 3244016..3244188 17..189 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:50:02 Download gff for BS24561.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 3138049..3138221 17..189 100   Minus

BS24561.pep Sequence

Translation from 16 to 189

> BS24561.pep
MEWKLLLIVLPWLLVCKIFYKVEDFTEPDVAYQSIDYHPEDYIDSFTDFQ
KHDYFQY*

BS24561.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:32:41
Subject Length Description Subject Range Query Range Score Percent Strand
ng4-PA 57 CG10789-PA 1..57 1..57 320 100 Plus