BS24561.complete Sequence
206 bp assembled on 2011-06-21
GenBank Submission: KX806361
> BS24561.complete
GAAGTTATCAGTCGACATGGAATGGAAACTGCTGCTAATAGTCCTGCCCT
GGCTGCTCGTATGTAAAATTTTTTATAAGGTCGAGGACTTTACGGAGCCT
GATGTCGCTTACCAAAGCATTGACTATCATCCCGAGGACTACATCGATTC
CTTCACCGACTTTCAGAAGCATGACTACTTTCAGTATTGAAAGCTTTCTA
GACCAT
BS24561.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:13:56
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
ng4-RA | 174 | CG10789-PA | 1..174 | 17..190 | 870 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:13:57
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
ng4-RA | 267 | CG10789-RA | 33..206 | 17..190 | 870 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:13:54
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23542271 | X | 3244015..3244188 | 190..17 | 870 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-26 15:13:55 has no hits.
BS24561.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-06-21 10:29:21 Download gff for
BS24561.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
ng4-RA | 1..173 | 17..189 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:50:02 Download gff for
BS24561.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
ng4-RA | 33..205 | 17..189 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:09:09 Download gff for
BS24561.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
ng4-RA | 33..205 | 17..189 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:09:09 Download gff for
BS24561.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 3244016..3244188 | 17..189 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:50:02 Download gff for
BS24561.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_X | 3138049..3138221 | 17..189 | 100 | | Minus |
BS24561.pep Sequence
Translation from 16 to 189
> BS24561.pep
MEWKLLLIVLPWLLVCKIFYKVEDFTEPDVAYQSIDYHPEDYIDSFTDFQ
KHDYFQY*
BS24561.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:32:41
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
ng4-PA | 57 | CG10789-PA | 1..57 | 1..57 | 320 | 100 | Plus |