Clone BS24575 Report

Search the DGRC for BS24575

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:245
Well:75
Vector:pDNR-Dual
Associated Gene/TranscriptLcp65Ae-RA
Protein status:BS24575.pep: full length peptide match
Sequenced Size:332

Clone Sequence Records

BS24575.complete Sequence

332 bp assembled on 2011-06-17

GenBank Submission: KX805423

> BS24575.complete
GAAGTTATCAGTCGACATGAAATTCCTGATCGTCTTTGTAGCAATCTTCG
CTTTTGCTTTGGCTAACGAAGCGCAAATTATTAACTTGGAATCCGATGTT
GGACCCGAAAACTTTCAGTGGTCCTTCGAGACCAGCGATGGCCAGGCGGC
TAACGCTAAGGGACAGTTGAAGTACCCTAACACCGACCACGAGTCCCTTG
CTGTCCAGGGATCCTTCCGCTTCGTTGCCGATGATGGCCAGACCTACGAA
GTCAACTACATCGCCGATGAGAACGGATTCCAGCCCCAGGGTGCCCATCT
TCCCGTTGCCTCCTAAAAGCTTTCTAGACCAT

BS24575.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 14:41:18
Subject Length Description Subject Range Query Range Score Percent Strand
Lcp65Ae-RA 300 CG10529-PA 1..300 17..316 1500 100 Plus
Lcp65Ag1-RA 318 CG10530-PA 205..306 209..310 405 93.1 Plus
Lcp65Ag2-RA 318 CG10534-PA 205..306 209..310 405 93.1 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 14:41:20
Subject Length Description Subject Range Query Range Score Percent Strand
Lcp65Ae-RA 476 CG10529-RA 39..340 15..316 1510 100 Plus
Lcp65Ag1-RA 517 CG10530-RA 266..367 209..310 405 93.1 Plus
Lcp65Ag2-RA 543 CG10534-RA 266..367 209..310 405 93.1 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 14:41:16
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 6137719..6137911 316..124 965 100 Minus
3L 28110227 3L 6137972..6138080 123..15 545 100 Minus
3L 28110227 3L 6133166..6133267 310..209 405 93.1 Minus
3L 28110227 3L 6134847..6134948 310..209 405 93.1 Minus
3L 28110227 3L 6130563..6130664 310..209 390 92.2 Minus
3L 28110227 3L 6145166..6145289 181..304 320 83.9 Plus
3L 28110227 3L 6147575..6147680 310..205 290 84.9 Minus
3L 28110227 3L 6150446..6150551 310..205 290 84.9 Minus
3L 28110227 3L 6136392..6136482 310..220 260 85.7 Minus
Blast to na_te.dros performed on 2014-11-26 14:41:18 has no hits.

BS24575.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-06-17 17:47:04 Download gff for BS24575.complete
Subject Subject Range Query Range Percent Splice Strand
Lcp65Ae-RA 1..298 17..314 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:40:29 Download gff for BS24575.complete
Subject Subject Range Query Range Percent Splice Strand
Lcp65Ae-RA 41..338 17..314 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:58:15 Download gff for BS24575.complete
Subject Subject Range Query Range Percent Splice Strand
Lcp65Ae-RA 41..338 17..314 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 15:58:15 Download gff for BS24575.complete
Subject Subject Range Query Range Percent Splice Strand
3L 6137721..6137911 124..314 100 <- Minus
3L 6137972..6138078 17..123 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:40:29 Download gff for BS24575.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 6130821..6131011 124..314 100 <- Minus
arm_3L 6131072..6131178 17..123 100   Minus

BS24575.pep Sequence

Translation from 16 to 315

> BS24575.pep
MKFLIVFVAIFAFALANEAQIINLESDVGPENFQWSFETSDGQAANAKGQ
LKYPNTDHESLAVQGSFRFVADDGQTYEVNYIADENGFQPQGAHLPVAS*

BS24575.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:17:11
Subject Length Description Subject Range Query Range Score Percent Strand
Lcp65Ae-PA 99 CG10529-PA 1..99 1..99 513 100 Plus
Lcp65Ag1-PA 105 CG10530-PA 1..102 1..98 349 67.6 Plus
Lcp65Ag2-PA 105 CG10534-PA 1..102 1..98 349 67.6 Plus
Lcp65Ag3-PA 105 CG18779-PA 1..102 1..98 346 66.7 Plus
Lcp65Af-PA 100 CG10533-PA 1..97 1..98 327 65.3 Plus