Clone BS24588 Report

Search the DGRC for BS24588

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:245
Well:88
Vector:pDNR-Dual
Associated Gene/TranscriptIM14-RA
Protein status:BS24588.pep: full length peptide match
Sequenced Size:173

Clone Sequence Records

BS24588.complete Sequence

173 bp assembled on 2011-06-21

GenBank Submission: KX802432

> BS24588.complete
GAAGTTATCAGTCGACATGAACTGTCTGAAGATCTGCGGCTTTTTCTTCG
CTCTGATTGCGGCTTTGGCGACGGCGGAGGCTGGCACCCAAGTCATTCAT
GCTGGCGGACACACGTTGATTCAAACTGATCGCTCGCAGTATATACGCAA
AAACTAAAAGCTTTCTAGACCAT

BS24588.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:12:20
Subject Length Description Subject Range Query Range Score Percent Strand
IM14-RA 141 CG33990-PA 1..141 17..157 705 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:12:21
Subject Length Description Subject Range Query Range Score Percent Strand
IM14-RA 223 CG33990-RA 32..176 15..159 725 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:12:18
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 20870555..20870631 83..159 385 100 Plus
2R 25286936 2R 20870423..20870492 15..84 350 100 Plus
Blast to na_te.dros performed on 2014-11-26 15:12:19 has no hits.

BS24588.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-06-21 10:23:36 Download gff for BS24588.complete
Subject Subject Range Query Range Percent Splice Strand
IM14-RA 1..132 17..148 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:49:41 Download gff for BS24588.complete
Subject Subject Range Query Range Percent Splice Strand
IM14-RA 34..165 17..148 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:08:32 Download gff for BS24588.complete
Subject Subject Range Query Range Percent Splice Strand
IM14-RA 34..165 17..148 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:08:32 Download gff for BS24588.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20870425..20870491 17..83 100 -> Plus
2R 20870556..20870620 84..148 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:49:41 Download gff for BS24588.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 16757930..16757996 17..83 100 -> Plus
arm_2R 16758061..16758125 84..148 100   Plus

BS24588.pep Sequence

Translation from 16 to 156

> BS24588.pep
MNCLKICGFFFALIAALATAEAGTQVIHAGGHTLIQTDRSQYIRKN*

BS24588.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:32:28
Subject Length Description Subject Range Query Range Score Percent Strand
IM14-PA 46 CG33990-PA 1..46 1..46 238 100 Plus