BS24588.complete Sequence
173 bp assembled on 2011-06-21
GenBank Submission: KX802432
> BS24588.complete
GAAGTTATCAGTCGACATGAACTGTCTGAAGATCTGCGGCTTTTTCTTCG
CTCTGATTGCGGCTTTGGCGACGGCGGAGGCTGGCACCCAAGTCATTCAT
GCTGGCGGACACACGTTGATTCAAACTGATCGCTCGCAGTATATACGCAA
AAACTAAAAGCTTTCTAGACCAT
BS24588.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:12:20
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
IM14-RA | 141 | CG33990-PA | 1..141 | 17..157 | 705 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:12:21
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
IM14-RA | 223 | CG33990-RA | 32..176 | 15..159 | 725 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:12:18
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 20870555..20870631 | 83..159 | 385 | 100 | Plus |
2R | 25286936 | 2R | 20870423..20870492 | 15..84 | 350 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-26 15:12:19 has no hits.
BS24588.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-06-21 10:23:36 Download gff for
BS24588.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
IM14-RA | 1..132 | 17..148 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:49:41 Download gff for
BS24588.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
IM14-RA | 34..165 | 17..148 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:08:32 Download gff for
BS24588.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
IM14-RA | 34..165 | 17..148 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:08:32 Download gff for
BS24588.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 20870425..20870491 | 17..83 | 100 | -> | Plus |
2R | 20870556..20870620 | 84..148 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:49:41 Download gff for
BS24588.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 16757930..16757996 | 17..83 | 100 | -> | Plus |
arm_2R | 16758061..16758125 | 84..148 | 100 | | Plus |
BS24588.pep Sequence
Translation from 16 to 156
> BS24588.pep
MNCLKICGFFFALIAALATAEAGTQVIHAGGHTLIQTDRSQYIRKN*
BS24588.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:32:28
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
IM14-PA | 46 | CG33990-PA | 1..46 | 1..46 | 238 | 100 | Plus |