BS24593.complete Sequence
281 bp assembled on 2011-06-17
GenBank Submission: KX805472
> BS24593.complete
GAAGTTATCAGTCGACATGAGAAAGGTCGTGTTAATTTGCTTACTAGCGA
GATTTAGCATCGGATTTCCCCAGGCTCACATATACAAGCCACTTCTTTGT
GAGGAAACCAATGCTAATATAACCAGATCTTCGCTTCTTGCACAATGTGT
AAATCAGGACGAATGTTTTATAAACAGACCAGTAGGTCTATGCCCCAAAC
TTGAAGTTTGCTGCGTTAAAAAACAAGATTTTAACATTGACGAGGTTGAA
TATATGGAAGATTAAAAGCTTTCTAGACCAT
BS24593.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 14:42:22
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Sfp77F-RB | 249 | CG42482-PB | 1..249 | 17..265 | 1245 | 100 | Plus |
| Sfp77F-RA | 249 | CG42482-PA | 1..249 | 17..265 | 1245 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 14:42:23
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Sfp77F-RB | 1093 | CG42482-RB | 20..269 | 17..266 | 1250 | 100 | Plus |
| Sfp77F-RA | 319 | CG42482-RA | 20..269 | 17..266 | 1250 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 14:42:21
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 3L | 28110227 | 3L | 20897092..20897262 | 266..96 | 855 | 100 | Minus |
| 3L | 28110227 | 3L | 20897320..20897398 | 95..17 | 395 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-26 14:42:22 has no hits.
BS24593.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-06-17 17:47:10 Download gff for
BS24593.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| Sfp77F-RA | 1..247 | 17..263 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:40:52 Download gff for
BS24593.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| Sfp77F-RA | 20..266 | 17..263 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:58:39 Download gff for
BS24593.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| Sfp77F-RA | 20..266 | 17..263 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 15:58:39 Download gff for
BS24593.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 3L | 20897095..20897262 | 96..263 | 100 | <- | Minus |
| 3L | 20897320..20897398 | 17..95 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:40:52 Download gff for
BS24593.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_3L | 20890420..20890498 | 17..95 | 100 | | Minus |
| arm_3L | 20890195..20890362 | 96..263 | 100 | <- | Minus |
BS24593.pep Sequence
Translation from 16 to 264
> BS24593.pep
MRKVVLICLLARFSIGFPQAHIYKPLLCEETNANITRSSLLAQCVNQDEC
FINRPVGLCPKLEVCCVKKQDFNIDEVEYMED*
BS24593.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:18:24
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Sfp77F-PB | 82 | CG42482-PB | 1..82 | 1..82 | 439 | 100 | Plus |
| Sfp77F-PA | 82 | CG42482-PA | 1..82 | 1..82 | 439 | 100 | Plus |
